SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166797015|gb|AAI59148| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166797015|gb|AAI59148|
Domain Number 1 Region: 50-518
Classification Level Classification E-value
Superfamily Sema domain 1.83e-152
Family Sema domain 0.0000000516
Further Details:      
 
Domain Number 2 Region: 514-563
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000174
Family Plexin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166797015|gb|AAI59148|
Sequence length 1084
Comment sema6d protein [Xenopus (Silurana) tropicalis]
Sequence
MTLRAGCAWALLLTVSTVCAVSFPEDDEPINVVDYHYSRQYPVFRGRPSGNDSQHSLDFQ
LMLKIRDTLYVAGRDQVYAINLNEVPKTEVTPSRRLTWRSGQADRKNCAMKGKHKDECHN
YIKVFVPRNDEMVFVCGTNAFNPMCRYYRLNTFDYDGEEISGLARCPFDARQTNVALFAD
GKLYSATMADFQASDAVIYRSMGDGFALRTIKYDSKWLKEPHFLHAIEYGNYIYFFFREI
AVEHNNLGKAVHSRVARICKNDLGGSQRVLEKHWTSFVKARLNCSVPGDSFFYFDVLQSI
TDIIEINGIPTVVGVFTTQLNSIPGSAVCAFTMDDIEKVFRGRFKEQKTPDSVWTAVPED
RVPKPRPGCCARHGYGEGYRSSTEFPDETLSFIKSHPLMDSAIPSIIEEPWFTKTRVRYR
LTAVAVDHLAGPYLNYTVMFVGSEAGVVLKILAKTNPFSLNDSVLLEEIDAYNRAKCSGN
SEEDRKVISLQMDRDHHALFVAFSGCIVRLPLSRCERYGSCKKSCIGARDPYCGWLNHES
CGRVKPGMFFGYEQDVEYGNTVQLGDCHDILPTATTPDYKIFGDPTSDIEVPSTSVTTTS
SPVILPKVIGSWKPRMTGSRKFIYQDDPNTSEYIDPLTGVQKGVRWEVQSGDANQMVHMN
VLITCVLAAFVLGAFIAGVIVYCYREMFVRKTRKIHKDAESAQSCTDSSGSFAKLNGLFD
SPVKEYHQSIDSPKHYTNILTSRKELPPNGETKSMMMDSQGQPPELAALPTPESTPVLHQ
KSLQPIKNQWEKTHNNLNISRKETPLKSPQFFPSSPPPHSPLAHGQIPSAVVIPNATHDY
NTSFSNSNAHKSDKKLHNLEHSLGKQSSKRDHRRSVDSRNTLNDFLKHLNESAGNPKALM
GDIQVTHPNGHQVPHQTLMLDTMGNMSEVPPKVPNREASLYSPSSTLPRNSPTKRVDVPS
TPNGQMTPIESQRSYHKNSSQRHSISAMPKNMNSPNGVLLSRQPSINRGGYMPPSPSTRM
DYMQGTPIIVHQQTSLSRQSSYTGHGTLPRMGVKRTPSIKPDVPPKPSFTSQNTSVRQLN
KYSY
Download sequence
Identical sequences B0JZE6
8364.ENSXETP00000039837 ENSXETP00000039837 ENSXETP00000039837 gi|166797015|gb|AAI59148| gi|187607673|ref|NP_001120152| NP_001120152.1.99540 XP_012814016.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]