SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|169642366|gb|AAI60557| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169642366|gb|AAI60557|
Domain Number 1 Region: 138-401
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.4e-40
Family Eukaryotic proteases 0.00047
Further Details:      
 
Domain Number 2 Region: 30-91
Classification Level Classification E-value
Superfamily GLA-domain 8.75e-24
Family GLA-domain 0.0003
Further Details:      
 
Domain Number 3 Region: 78-156
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000251
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169642366|gb|AAI60557|
Sequence length 403
Comment proz protein [Xenopus (Silurana) tropicalis]
Sequence
MLFIHQAEAKVFLSSENANKVIQRSKRDNFIFIEELLKGNLERECLEERCSYEEARETFE
NTEKTKQFWSQYHGGMKCSLNPCKNQGSCKDTIRSYICSCPEGYTGRDCQFANNECHPDM
EDGCQHFCHPSYEADSYSCSCANGYKLGADEKSCHPEDPFACGQILNLEVSITKNRNHLQ
ADIFPWQVPVLNSQKVQVCSGVVLSESVVLTTASCITMYDPYFVVAGVQQKSGLGQRQMI
RVKTKQVHMRYSEETGDNNIALLKLKEKIVFHNNSLPICIPQKDFAENVLVPFNTGLVSG
WKSSSEEEADALIPIQFYTKYTNRTEVCEQSLNVTQTNRMFCGVSHEAIDSELSEGGHLA
VQHNGVWFLGGIMGSWQPTLLNKGVFSFTKLSRYNMWLKQNGS
Download sequence
Identical sequences B1H1C8
gi|169642366|gb|AAI60557|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]