SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170284481|gb|AAI61011| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170284481|gb|AAI61011|
Domain Number 1 Region: 29-123
Classification Level Classification E-value
Superfamily Immunoglobulin 1.13e-18
Family I set domains 0.0037
Further Details:      
 
Domain Number 2 Region: 133-181
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000388
Family I set domains 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170284481|gb|AAI61011|
Sequence length 206
Comment LOC100145434 protein [Xenopus (Silurana) tropicalis]
Sequence
MQVPSCQTMNIARPVVVLLCFLLHAGAETPPKLTRTPVDQIGVSGGVASFICQATGDPRP
KIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNSVGEVATTTRL
TVLREDQIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDYLPVDTSNNNG
RIKQLRSESIGGTPIRGKITELTFAE
Download sequence
Identical sequences B1H2I2
gi|170284481|gb|AAI61011| gi|170284796|gb|AAI61048| gi|187607337|ref|NP_001120361| NP_001120361.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]