SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170285174|gb|AAI60976| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170285174|gb|AAI60976|
Domain Number 1 Region: 102-158
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-21
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 46-102
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 8-59
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-17
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 143-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000475
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170285174|gb|AAI60976|
Sequence length 199
Comment hypothetical protein LOC100135392 [Xenopus (Silurana) tropicalis]
Sequence
MERTAVNCFTCTQCGKSFSHKCSLKRHMLIHTGERPHKCPQCDMRFRYLGNLKTHMMIHT
KEKPHKCSHCDMRFTYLGNLKTHMLVHTGERPYKCSHCDMNFNNLANLKRHMLLHTGEKT
HQCDQCSKTFKRPADLKIHLRVHTNERPYSCSECGKSYTMKSTLKNHQKTHTGVTEFVCE
VWEDFHFSKSLENAPEDSH
Download sequence
Identical sequences A7MC87
NP_001098415.1.45394 XP_009294064.2.45394 XP_017208676.1.45394 ENSDARP00000097261 gi|163915677|gb|AAI57708| gi|166158354|ref|NP_001107527| gi|170285174|gb|AAI60976| ENSDARP00000097261 7955.ENSDARP00000097261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]