SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|171847144|gb|AAI61571| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171847144|gb|AAI61571|
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily Immunoglobulin 6.93e-20
Family V set domains (antibody variable domain-like) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171847144|gb|AAI61571|
Sequence length 193
Comment scn2b protein [Xenopus (Silurana) tropicalis]
Sequence
MEVTVPATVYALNGTDARLPCKFNSCYKMDNKLFSVNWTYKSCENCSEEMFIQYNKKLSY
HNLERFQNRVEFTGNPTKNDLTVMIHDVQLQDIGDYYCYVLNPPDRDRGTGKIHLEVRTE
VPPERDSTVAVLVGASVGGFLAIVILILVIVKCVRRKKQQNLNSEDQKTEEEVKTDGEGN
TGGELKAAIPEVP
Download sequence
Identical sequences B1WB09
gi|171847144|gb|AAI61571| ENSXETP00000056834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]