SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|172044151|gb|A4IGL7| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|172044151|gb|A4IGL7|
Domain Number 1 Region: 725-1303
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 9.42e-204
Family Myeloperoxidase-like 0.000000000375
Further Details:      
 
Domain Number 2 Region: 36-239
Classification Level Classification E-value
Superfamily L domain-like 9.07e-42
Family Ngr ectodomain-like 0.0029
Further Details:      
 
Domain Number 3 Region: 332-426
Classification Level Classification E-value
Superfamily Immunoglobulin 6.8e-27
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 419-510
Classification Level Classification E-value
Superfamily Immunoglobulin 2.38e-24
Family I set domains 0.0057
Further Details:      
 
Domain Number 5 Region: 235-330
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-23
Family I set domains 0.01
Further Details:      
 
Domain Number 6 Region: 517-604
Classification Level Classification E-value
Superfamily Immunoglobulin 9.03e-23
Family I set domains 0.029
Further Details:      
 
Domain Number 7 Region: 1394-1452
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000481
Family VWC domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|172044151|gb|A4IGL7|
Sequence length 1457
Comment RecName: Full=Peroxidasin; Flags: Precursor
Sequence
MAGAGSWLYLTAGLLVVALPQLSHSCPSRCLCFRTTVRCMHLMLESVPAVPPHTTILDLR
FNRIKDIQTGAFKHLKNLNTLLLNNNQIKRIPSEAFKDLENLKYLYLYKNEIQSIDRQAF
KGLASLEQLYLHFNQIETLEPESFNYLPKLERLFLHNNRITHLVPGTFSQLESMKRLRLD
SNALHCDCEILWLADLLKIYSESGNAQAAATCEYPRRLQGRSVSTITPSELNCERPRITS
EPQDVDVTFGNTVYFTCRAEGNPKPEIIWLRNNNELSMKDDSRLNLLNDGTLMIQNTKET
DQGIYQCMAKNVAGEVKTHEVTLRYYGTPATPTFVIQPQNTEVLVGESVTLECSATGQPH
PRVTWTRGDRTPLPSDPRINITPSGGLYIQNVNQDDAGEYTCFATNSVETIHSTAYIIVQ
AVPQFTVVPQDRNVFEGHTVDFHCEAQGNPKPVIAWTKGGNQLSVDRRHQVLSSGTLRIL
RVALHDQGQYECQAVNIVGSKSTAAQLIVQTRVTPVFATVPNDMTVEVGTDVQIPCSSQG
DPLPIITWNKDGIQVTESGKFHISPHGYLAIRDAGLADQGRYECVARNPIGYSSVSMVLS
VLVPEVSRTGDPFVATSIIEAIATVDRAINSTRTHLFDSRPRSPGDLLALFRYPRDPYTV
EQARAAEIFERTLQLIQDHVQSGLMVDLNGTSYHYNDLVSPQYLNMIANLSGCATHRRIN
NCSNMCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNLPRGISGRIYNGFP
LPLPRLVSTTLIGTHTITPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQDCSVVC
TNDAPCFPIMVPPNDPRVRNNARCMSMVRSSPVCGSGMTSLLMNSVYPREQMNQLTSYID
ASNVYGSSDHESNEIRDSASHRGLLKQGIVQRSGKPLLPFATGPPTECMRDENESPIPCF
LAGDHRANEQLGLTSMHTLWFREHNRIATELLRLNPHWDGDTIYHETRKIVGAQMQHITY
SHWLPKIFGDVGMKMLGEYKSYDPNVNAGILNEFATAAFRFGHTLINPILYRLDEKFEPI
PQGHVPLHRAFFSPFRIVNEGGIDPLLRGLIGVAAKMRVTSQLLNTELTEKLFSMAHAVA
LDLAALNVQRGRDHGIPPYHDFRVFCNLSTVQTFDDLRNEIKNPDVREKLKRLYGSPLNI
DLFPALMVEDLIPGSRLGPTLMCLLTTQFRNIRDGDRFWYENPGVFTAAQLTQIKQTSLA
RVLCDNGDNITKVQHDLFRVAEFPHGYVSCKNIAKMDLRVWQDCCEDCRTRGQFSTFSNH
FRGKRSTEHSYKEDNKEPSSLLNQSVNTTCNTEQPKNLPHVNDFKEFVLDMQKTITGLRK
QIKKLESRLSNTDCTDETGESHSTKEKWNKDACTKCECYNGHITCFVKSCPPVNCSRPQR
IEGVCCPVCTDDKIQST
Download sequence
Identical sequences A4IGL7
gi|134024022|gb|AAI35156| gi|172044151|gb|A4IGL7|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]