SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|183985760|gb|AAI66334| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183985760|gb|AAI66334|
Domain Number 1 Region: 6-86
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-18
Family SH3-domain 0.0011
Further Details:      
 
Weak hits

Sequence:  gi|183985760|gb|AAI66334|
Domain Number - Region: 555-663
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0162
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|183985760|gb|AAI66334|
Sequence length 951
Comment bcar1 protein [Xenopus (Silurana) tropicalis]
Sequence
MNYLNVLAKALYDNVAESPDELSFRKGDIMTVLERNTQGLEGWWLCSLHGRQGIVPGNRL
KILVGMYDKKQGSGDQCQQKPQQQTQQQPPQIPLNYQPQGVYNVVTSSNQYTPMHSAYQS
PGGEHVYLMPASSKGQQGLYQNPQGPQHPGQITPSKQPSLYQNQPAQHPFPSQVQDIYQV
PPSLNQSQELYQVPVGSISPPQPHDVYQVPPSSGTVQDIYHVPPSITSSQEIYQVPPSMD
MRAVEVRKAPGKVVLPTRVGQLYVYDTPKLEQQDEYDVPRHLGPSGPQEIYDVPSRCLVN
NYSPEVYDIPPMAVKGPVSREQTQEIYDVPPSIEKNLHDQLQSHLMIYDIPPSVSKDVPD
GPTREETYDFPPTFPSQKMQGPPQATTHALHEHEPNIPEEIYDIPPTAIKGSDTSFSQEI
YDVPPSLRKPAGQTFHHDVYDVPREFHSGKPTTESETDYIYDVPPQVDREVKAVDELVGN
FKRLSASSTGSTRSNISTSSLDTIPVKEPAVILPKPAGKELNLDLEAAMELLVKLQHGVN
SSVSYLMSFLNGPWRSLEQMEANIQSIQSAVEGVKSAMKELLEFARGAVVNSAQASDRTL
HTKLSKQLQKMEEVNQQLIKHSQALDNCNWSLNILATNKQNTSDDLERFIMYSKGIPDDT
KQLASFLHGNASLLFKRAKHPLSLSDLQDNSNHFSNNNNNLSVGQTGHTEKASIQSRPLP
SPPKFLAEQSPEGQYENNESGWMEDYDYVHLQGKEEFEKTQKELLEKGNIIKQGKGHLEQ
QQLKQFERLEEEVVRPIESDLSNWTPPQHYSKVQSALSNSDRQLLLFYQEQCEANVTTLT
NAIDAFYNSISSNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAQDIRNKVTHHSNLL
CDKLKEIVLTTKTAALQYPSPAAAKDMVDRVKDLNSSSQQFRMVLGQLVAM
Download sequence
Identical sequences B2GUM2
gi|183985760|gb|AAI66334| gi|186910233|ref|NP_001119536| NP_001119536.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]