SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|183985766|gb|AAI66344| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183985766|gb|AAI66344|
Domain Number 1 Region: 124-353
Classification Level Classification E-value
Superfamily Kelch motif 1.96e-47
Family Kelch motif 0.0069
Further Details:      
 
Domain Number 2 Region: 589-671,706-736
Classification Level Classification E-value
Superfamily POZ domain 1.06e-21
Family BTB/POZ domain 0.011
Further Details:      
 
Domain Number 3 Region: 36-127
Classification Level Classification E-value
Superfamily Kelch motif 3.79e-20
Family Kelch motif 0.016
Further Details:      
 
Domain Number 4 Region: 357-406,441-472,512-542
Classification Level Classification E-value
Superfamily POZ domain 7.33e-16
Family BTB/POZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|183985766|gb|AAI66344|
Sequence length 778
Comment LOC100158621 protein [Xenopus (Silurana) tropicalis]
Sequence
MACKSKVAPSVDFDHSCSDSVEYLTLNFGPFESVHRWRRLLPCDEFVGARRSKHTVVAYK
DAIYVFGGDNGKNMLNDLLRFDVKDCSWCRAFTTGSPPAPRYHHSAVVYGSSMFVFGGYT
GDIYSNSNLKNKNDLFEYKFATGLWTEWKIEGRLPVARSAHGATVYSDKLWIFAGYDGNA
RLNDMWTIGLQDRDLTCWEEIEQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNNLFQ
FEFSEKVWTRIPTEHLLRGSPPPPQRRYGHTMVAFDRHLYVFGGAADNTLPNELHCYDVD
SQSWEVIQASPDSELPSGRLFHAAAVIADAMYIFGGTVDNNVRSGEMYRFQFSCYPKCTL
HEDYGRLFENQQFCDVEFILGEKEERVRGHTAIVTARCKWLRKKIMQARERQKQKLKQEP
EDEMQNSQQKTESACSQVKLSRSQPMLEVIIRDAEARPFELLMQFLYTDKIKYPRKGHVE
DVLLIMDVYKLALHFKLSRLEQLCVQYIEASVDLQNVLGVCENANKLQLDELKEHCLNFV
VKESHFNQVIMMKEFEHLSSSLIVEIVRRKQQPPLRIHSDQPVDIGTSLVQDMKAYLEGA
GNDFCDITLLLDGHPRPAHQAILAARSSYFEAMFRSFMPEDGQVNISIGEMVPSKQAFES
LLRYIYYGEVNMPPEDSLYLFSAPYYYGFFSNRLQAYCRQNLEMNVTVENVLQILEAADK
TQAVDMKKHCLHIIVHQFTKVAKLPNLRLLSQPLLINIIESLASHISDKQCAELGSDI
Download sequence
Identical sequences B2GUN2
gi|183985766|gb|AAI66344| gi|189230029|ref|NP_001121508| NP_001121508.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]