SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|183986447|gb|AAI66183| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183986447|gb|AAI66183|
Domain Number 1 Region: 27-517
Classification Level Classification E-value
Superfamily Sema domain 1.96e-181
Family Sema domain 0.00000000000778
Further Details:      
 
Domain Number 2 Region: 513-564
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000384
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 570-662
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000385
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|183986447|gb|AAI66183|
Sequence length 773
Comment sema3b protein [Xenopus (Silurana) tropicalis]
Sequence
MKLQRSLLSLCLLLYFGLIGSNKVTPRLKLSYQDLMSLHGLRTFTLERSCCYDALFLDEE
RGRLFVGGKNYLMSLSLDNISKQELAIHWPAPVEWREECNWAGKDINVDCMNYVKILQPY
NRTHLFTCGTGAFHPTCGFVHVGQRTDDTVFKMDLRRMEDGKGRCPYDPKHIAAAVLVGD
ELYSGVATDLMGRDFTIFRSLGRRPPLRTEQHDSRWLNEPKFVKVFWIPESENPDDDKIY
FFFKETPVEGAGGVKQSYARIGQICRNDLGGQRSLVNKWTTFLKARLVCSVPGNEIGGDT
HFDELRDVFLLQTRDRRNPLIYALFSTSSSVFRGSAICVYTMNDVRRAFLGPFAHKEGPN
YQWVSYQGKVPYPRPGMCPSKTFGSFESTKSFPDDVLQFARNHPLMFNPVVPGSGRPVFL
RSHGDLSFTQLAVDRVAAADGEYDVMFIGTDVGSVLKVISVPKQSWHHVEQVVLEELQVF
KNASPITTMQISSKRQQIYVGSASGISQLPLHRCGIYGKACAECCLARDPYCAWDGASCT
RFLPNTKRRSRRQDVRNGDPNTLCSGEQQRFSVQEKRLLGVEGSSIFLECLPKSLRAQVT
WTYQKAPESSRTEVQFDERVLQTDRGIVVRNVLRRDAGTFICYSSEHGFTQTLLRLHLEV
IPSSRTEEHLGLQRVPHNRWYQDFMRLVQQPGSVEQMCEEIWTRKGRTSHPPGPQGAPHV
PGSQGRSLPAVPPLNIKTKAQKWKHLEDKRKVRSRRTHEQLSRAERGPRSAPS
Download sequence
Identical sequences B2GU89
gi|183986447|gb|AAI66183| gi|188528965|ref|NP_001120908| NP_001120908.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]