SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186972153|ref|NP_001016007| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186972153|ref|NP_001016007|
Domain Number 1 Region: 76-487
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.38e-74
Family L-arabinose binding protein-like 0.0023
Further Details:      
 
Weak hits

Sequence:  gi|186972153|ref|NP_001016007|
Domain Number - Region: 803-844
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0654
Family Mitotic arrest deficient-like 1, Mad1 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186972153|ref|NP_001016007|
Sequence length 962
Comment gamma-aminobutyric acid (GABA) B receptor, 2 [Xenopus (Silurana) tropicalis]
Sequence
MAPSPRRRWNSPCALPGAETPQAAGAGGAESATGVSPKPAIQMPMLPPQCLLLVLGLGLG
PGFVYGSRGTTIEQPANGTSLSIMGLMPLNETVAKGNIGRGVLPAVQLAIDQIRNISLLH
PYFLDLKLYDTACDNAQGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLKGWNLVQLS
FAATTPVLADKKKYPYFFRTVPSDNAVNPAIVKFLKHFKWKRVGTLTQDIQRFSEVRNDL
TGELEDSAIQIADTESFSNDPCSSVKKLKGNDVRIIIGQFDEHMAAKVFCCAFDEDMYGS
KYQWIIPGWYQALWWQQANTSTCSTKNLLTAMEGYIGVDFEPLSTKQIKTISGRTPQQYE
KEYNEKRAGVEPSKFHGYAYDGIWVIAKTLHRALEYLYSSKQRQRIQDFNYTDHKLGKIF
LDAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDGKEVKVGEYNAVADSLELINDTIRFQ
GVEPPKDQTFIREERRQIYLPLYSILSTLTIIGMIMASTFLFFNIKNRNQKLIKMSSPYM
NNLIILGGMLSYASIFLFGLDGSFVSANTFETLCTVRTWILTVGYTTAFGAMFAKTWRVH
AIFKNVKMKKKIIKDQKLLVIVGGMLLIDLCILICWQIVDPLKRTVEEYNLEPDPAGRDI
AIRPFLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNV
GIMCIIGAAVSFLTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRR
FQFTHNQKKEDSKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDT
PEKTTYIKQNHYQDLNDILSIRNFTDNKDGEKAVLKNHHDQKASSQWNTIESSKTSKDPI
EDINSPEHIQRRLSLQLPILHHAYLPSIGGVDASCASPCVSPSASPRHRHVQPSFQVMVS
GL
Download sequence
Identical sequences A8KBC6
gi|158254237|gb|AAI54061| gi|186972153|ref|NP_001016007| NP_001016007.2.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]