SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|187607137|ref|NP_001120287| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187607137|ref|NP_001120287|
Domain Number 1 Region: 133-261
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.98e-31
Family Eukaryotic proteases 0.0000483
Further Details:      
 
Domain Number 2 Region: 54-156
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000589
Family Hepsin, N-terminal domain 0.0000396
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|187607137|ref|NP_001120287|
Sequence length 262
Comment hepsin [Xenopus (Silurana) tropicalis]
Sequence
MVEKEGMGKGCRWTSQRILGVTLCVLISLAGIGVIAWAVVTYVLKNENQNLYIVQVNLPD
HRLSVYDEKEKVWRLVCSSFSNPEVATLSCEEMGFIRSVSHQELRVETAGTNGTSGYYCV
HESQINSAKRLLDILTVCECPSGRFLSVQCQDCGRRKLAVDRIVGGQDATLGRWPWQVSL
RYDGAHLCGGSLISSEWVLTAAHCFPERNRIVSQWRVFAGAVSQLSPRGKLLGVKGIIYH
SGYLPFLNPTVRRTATTLPWCI
Download sequence
Identical sequences B1H1D2
NP_001120287.1.99540 gi|169641896|gb|AAI60561| gi|187607137|ref|NP_001120287|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]