SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|187607189|ref|NP_001120599| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187607189|ref|NP_001120599|
Domain Number 1 Region: 154-225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.57e-17
Family Complement control module/SCR domain 0.0007
Further Details:      
 
Domain Number 2 Region: 215-282
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000113
Family Complement control module/SCR domain 0.00067
Further Details:      
 
Domain Number 3 Region: 396-465
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 454-511
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000117
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 271-335
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000334
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 6 Region: 90-164
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000473
Family Complement control module/SCR domain 0.00066
Further Details:      
 
Domain Number 7 Region: 28-94
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000167
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 8 Region: 350-407
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000183
Family Complement control module/SCR domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|187607189|ref|NP_001120599|
Sequence length 562
Comment amphibian RCA protein 3 [Xenopus (Silurana) tropicalis]
Sequence
MHSPFNIKNQWALLFYIANQIIETFGECGPPPALLHTVPIDGKSFPVDESVVYSCNKTAG
YYEIPGRSRTITCQDDFTWSTVPEFCIRACDSPPRLDFAQLGQEDINKNIYLNGTTVKYD
CRPGYKRIPGTDRTISCLDNFTWTAPQSFCQRRSCGHPGEIDNGEFEPTDSEFLFGSTVT
YKCNEGYRMISKQLSKTCKSDGKWSISFPQCEVMVCTAPGDINDGFYKPQKEEYHYQEAV
TYGCNNNFALIGNRSAYCTSDGTWSSQAPVCKDVKCPEPNVPNARKSSGFLGPYLLRSAV
SFKCDEGFMMNGSDIIKCNVENQWDPLPECLRFCTLPSLEYAKLREKYSNRKGFFAGTTL
EYDCLPGHRLRLNTEPTIKCLDTFQWSSMKTSCEQIVCEHPQDFSKGRINTQGPYKYQTR
VTVICDEGYTTKTNHLECQIDGTWSNYPPVCEEIVCKHPGEFSNGKIDTQGPYKYNTKVT
FICNEGYTAKTSHLECKIDGTWSNYPPVCEAHRMSTWLIVGIIVIVIVIVFIIAICLYCY
NKKQSGKQKAEMHNVQYTACTA
Download sequence
Identical sequences B1WB66
NP_001120599.1.99540 gi|171846402|gb|AAI61634| gi|187607189|ref|NP_001120599| gi|237512855|gb|BAH58780|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]