SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|187607327|ref|NP_001120205| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187607327|ref|NP_001120205|
Domain Number 1 Region: 115-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000524
Family EGF-type module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187607327|ref|NP_001120205|
Sequence length 226
Comment uncharacterized protein LOC100145251 precursor [Xenopus (Silurana) tropicalis]
Sequence
MFSLRSVILCATLLLTIACNFTVHCSELNSTQADSNVTFSGDHGSDGTGSAVEVNWEEEE
GEEHEDDFSILGFITDDSIRAEPVIKPENPPKKGEKKNSEKKKKKERGDKKKKKKKNPCQ
TTHKDYCIHGECKYLTSLQEVTCICQPEYFGERCSEQSMKSQTKGNLSDTSTIALAVVAV
LLSTISITAIIIIIVVHTRRKYASYQCEVEEKKRLGQENGSEEIDV
Download sequence
Identical sequences B0JZV6
NP_001120205.1.99540 gi|166796458|gb|AAI59335| gi|187607327|ref|NP_001120205|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]