SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|187607774|ref|NP_001120551| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|187607774|ref|NP_001120551|
Domain Number - Region: 444-550
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00191
Family Myosin rod fragments 0.0091
Further Details:      
 
Domain Number - Region: 560-663
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00262
Family Myosin rod fragments 0.0028
Further Details:      
 
Domain Number - Region: 651-729
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00366
Family Myosin rod fragments 0.0041
Further Details:      
 
Domain Number - Region: 164-189,238-427
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0445
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187607774|ref|NP_001120551|
Sequence length 770
Comment cingulin-like 1 [Xenopus (Silurana) tropicalis]
Sequence
MQGSSQVAQATPDLLKGQQQVALQTNEETAKQILFNYLKEGSPDNDDATKRKVNLVFEKI
QTLKSRAANTVQDPSADIKVLLEQKKELEKRVAALQERLDEEIKNHKRDKEDSNTKANMK
DFHDQLEQSMDENLVLRKRLGESEKELRKHLDELFELKMEQEQYQTEIRDLQEQLSEMHD
ELDNAKSSVVDGEREVFIEELMQMKQSFQEVLLAKEEQEDLLRRRERELTALKGALKEEV
ATHDQELDKLKEQYDKELKSIRDNLTAAVKNSSDIANQKDEANQLKAVFENRVKGLLQEN
EELKSKIENLEAKIAALRQEIKDLNEENERIKDKLSKSEKEKQQLAIALENSKDQEKETL
QFARKLENQLEDTKRSLSRVSHEHQQLTERLKEEANQKEQLRNLKNEMENERWQLDKTIE
KLQKEISENVEFSRMSTVELQKQFDEYKDKYRRESAEMQRQIKDKNLEVERACQTIKKLQ
DEVRHLEENLQDHQRAQDEALTKNHLLQQTIKDLQYELDAKTHVKDDRIRQIKSMEDKLS
QLEMELDEEKNNSDLLLERVTRCREQIEQTRSELFQERAAKQDLECDKISLERQNKDLKS
RIVHLENSHRSNKEGLVAQMETRIAELEERLENEERERASLQLNNRRLERKVKELMMQVD
DEHLTLTDQKDQLSLRLKSMKRQVEEAEEEIDRLESAKKKLQRDLEEQTDINDQLQTQLT
AAKKELSRRKSSPSRMNDLEDDDDDLSTDGESLYDGPSVYTFSRDDGIRA
Download sequence
Identical sequences B1WAS7
gi|171846931|gb|AAI61484| gi|187607774|ref|NP_001120551|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]