SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|187608512|ref|NP_001120579| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187608512|ref|NP_001120579|
Domain Number 1 Region: 293-411
Classification Level Classification E-value
Superfamily EF-hand 3.78e-30
Family Osteonectin 0.013
Further Details:      
 
Domain Number 2 Region: 201-273
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.36e-21
Family Thyroglobulin type-1 domain 0.0016
Further Details:      
 
Domain Number 3 Region: 86-161
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.7e-18
Family Thyroglobulin type-1 domain 0.0012
Further Details:      
 
Domain Number 4 Region: 33-87
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000277
Family Ovomucoid domain III-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187608512|ref|NP_001120579|
Sequence length 432
Comment SPARC related modular calcium binding 1 precursor [Xenopus (Silurana) tropicalis]
Sequence
MIPRVIALFVTCHFVLLHLPQCCGQRATGPRFLISDRDRDPQCNPHCTRPQHKPVCASDG
RTYESMCDYQRAKCKDATLSVTHRGRCKDAGQSKCRLERTQALEQAKKPQEAVFIPECNE
DGSFTQVQCHTFTGYCWCVTPDGKPVSGSSVQNKTPVCSGSVTEKPSSQGNSGRRDITAP
TLWIKHLVIKDAKLNSSSVKHPANSCDQERQSALEEAKLNPRDGIVIPECAPGGLYKPVQ
CHQSTGYCWCVLVDTGRPLPGTSTRYETPVCESDARWKNTDAEDPFKDRELAGCPEGKKL
EFITSLLDALTTDMVQAINSAAPAAGGRFSEPDPNHTLEERVVLWYFSQLDSNGSEDINK
KEMKPFKRYVKKKAKPKKCARRFTDYCDLNKDKSISFPELKGCLGVRKEPGANAGSFPPG
KRPGSNPFSRLV
Download sequence
Identical sequences B1WB02
NP_001120579.1.99540 gi|171846331|gb|AAI61563| gi|187608512|ref|NP_001120579|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]