SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|189441777|gb|AAI67576| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189441777|gb|AAI67576|
Domain Number 1 Region: 313-497
Classification Level Classification E-value
Superfamily Kelch motif 2.35e-51
Family Kelch motif 0.0000267
Further Details:      
 
Domain Number 2 Region: 449-595
Classification Level Classification E-value
Superfamily Kelch motif 7.06e-40
Family Kelch motif 0.00011
Further Details:      
 
Domain Number 3 Region: 40-157
Classification Level Classification E-value
Superfamily POZ domain 1.15e-29
Family BTB/POZ domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|189441777|gb|AAI67576|
Sequence length 616
Comment hypothetical protein LOC550043 [Xenopus (Silurana) tropicalis]
Sequence
MASESVLPEQVKPRQAKGRRQIQREKSLTSEVDGDGTFVFEADEAWKEFHRSLLHFYEVG
ELCDVTLKVGSKLIPCHKLVLACVIPYFRAMFLSDMAETKQTLIEIQDFDGDAIEDLVKF
SYSSCVTLTVDNVQPLLYAACILQVELVAKACCEYMKLHFHPSNCLAVRAFAESHNRVDL
MDMADRYACDHFTEVVDCDDFVTMTPQHLYKLLSSGDLNIENEKQVYNAAMKWLHANPQY
HTAWLDEILSQVRLPLLPVEFLMSVVAKEDIIKQNLKCRDLLDEARNYHLYLSNRSLPDF
EYTARTIPRKQTAGVLFCVGGRGGSGDPFRSIECYSVTKNSWFFGPEMNSRRRHVGVISV
GGKVYAVGGHDGNEHLGSMELFDPLTNKWMMKASMNTKRRGIALSSLGGPIYAIGGLDDN
TCFNDVERYDIESDHWTSVAPMISPRGGVGSVALMSHVYAVGGNDGVASLSSVERYDPHL
DKWVEVKEMGQRRAGNGVSELHGCLYVVGGFDDNSPLSSVERYDPRMNKWDYVSELTTPR
GGVGIATLMGKIYAVGGHNGNAYLNTVESYDPRINRWELVGSVAHCRAGAGVAVCACLCS
QIRDVGQGSSNVVDCM
Download sequence
Identical sequences Q28D69
gi|189441777|gb|AAI67576| gi|62859763|ref|NP_001017289| gi|89273891|gb|CAJ83909| NP_001017289.1.99540 XP_017949260.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]