SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|189442705|gb|AAI67577| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189442705|gb|AAI67577|
Domain Number 1 Region: 141-406
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.15e-80
Family Nuclear receptor ligand-binding domain 0.00000000359
Further Details:      
 
Domain Number 2 Region: 89-169
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.04e-30
Family Nuclear receptor 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|189442705|gb|AAI67577|
Sequence length 412
Comment rxrb protein [Xenopus (Silurana) tropicalis]
Sequence
MVGSAMTSSVNSPLGSIGSPFQVINCSVGSPGIPGTPSIGYGPVSSPQINSTVNLSGLHP
VSSSEDVKPPLGMRSMSSHPNGGAVSGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIR
KDLTYTCRDNKDCIVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKERDGEAEFSGA
INEEMPVEKILEAELAVEQKSDQSLEGGGSPSDPVTNICQAADKQLFTLVEWAKRIPHFS
ELPLDDQVILLRAGWNELLIASFSHRSISVKDGILLATGLHVHRNSAHSAGVGAIFDRVL
TELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPGDVEVLREKVYASLESYCKQKYPD
QQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLS
Download sequence
Identical sequences B3DLT9
gi|189442705|gb|AAI67577| XP_012823808.1.99540 XP_012823809.1.99540 XP_012823810.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]