SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|194332709|ref|NP_001123844| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194332709|ref|NP_001123844|
Domain Number 1 Region: 328-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000362
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  gi|194332709|ref|NP_001123844|
Domain Number - Region: 61-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0123
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 230-337
Classification Level Classification E-value
Superfamily SEA domain 0.0654
Family SEA domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194332709|ref|NP_001123844|
Sequence length 911
Comment uromodulin-like 1 [Xenopus (Silurana) tropicalis]
Sequence
MITGALCPLNTTVHHISTKPEGIFAVKSQILIGVNELDSLPNISAKLNGIVTRIPEIISI
HLEDINECLHMELHPCLPGELCTKENGSYQCSRPNTNEQIRPPLHMSHWTTETPPLASPE
PGPKNLSSRLPPPPVSSNGTRPFCNCSVFKYLRISNVSSGGFDMDWSTDCPENQTYHVHV
YAQNGFTSRREIRQTYTEIRGLMAGDLCMVNVSFMDCMGHVHWKEGRIKHDAQILNVTLK
ITNHNLTEALSNSSSGEYLDFVTKFVQETKQALSKDFAPAELMVEVESLRAGSIIVCFTV
TVIDSLVPLNLSRLPVSFRSSSFVIDEKSVIIEDFNECSSPLDNDCHTSAQCINLYLSYT
CQCLEGFTDIYLSRPGRNCVGMMGLVGPQLLNVTHSGRMNEPSPTNAADTSFQTSVTPGT
SLYATTENMEANTSATFIPPGDTNTSHSVESYHIGNSTALIMEQPKGENVTNMAAALPAP
VPTQNESNVSVWNTTTTTGDTTHTDTPHGSSQPPTDIPTSYNVTYGITPNRTTMGLPVAS
STVPTGTTVSPLMPTTSTTMEMSQPPAVQVTAMQLKSASTLICDTGRIGIIIQRSYLRQK
FIDESSLYLGNPECNVTQTNDTHVLLQAGWNECGTEEHSNKTNIMVNTSLYHNLLTYPNP
TPRQLGTIRCVFSNDILASTGYTPSGGFLTIIEKLEGDGTFMPEFQLFSGDQPMSENLTF
NATDNIKVQIRIKADDSQLKVVISDCWATPSLSSDDPISFPFIKQSCAVKETYTVIHTNG
ISNNATFETKLFSFVGDHSVVYIHCRLHVCKESEGSSCKPTCGAVSARSSSPNIFTGLTR
LGPIHQSPRAHKEETPEKPQLGPGYITLIIVAVLAFVASLAAIFICWHERRTGKYNFTFK
CQDVGYQVFSN
Download sequence
Identical sequences B3DM56
gi|189441861|gb|AAI67710| gi|194332709|ref|NP_001123844|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]