SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|197245687|gb|AAI68636| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197245687|gb|AAI68636|
Domain Number 1 Region: 213-317
Classification Level Classification E-value
Superfamily SRCR-like 1.26e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000933
Further Details:      
 
Domain Number 2 Region: 2-104
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 107-210
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000933
Further Details:      
 
Domain Number 4 Region: 426-530
Classification Level Classification E-value
Superfamily SRCR-like 1.11e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000805
Further Details:      
 
Domain Number 5 Region: 319-423
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 6 Region: 533-599
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197245687|gb|AAI68636|
Sequence length 606
Comment Unknown (protein for MGC:186337) [Xenopus (Silurana) tropicalis]
Sequence
MKLVNGANRCAGRVEILYMGSWRTVCDDSWDMADGEVVCRQMGCGNAVFIHGNAHFGQGS
GPILLDNVNCKGSESFLWDCPNAGLGTHNCQHSEDAGVTCSDIFPKTIKLVNGANSCAGR
VEILYMGSWATVCDDSWDMADGEVVCRQMGCGNAVSIHGSAHFGQGSGQILLDDVNCKGS
ESFLWDCPNAGLEKHNCNHGEDAGVTCSGTSKTVKLVNGTNSCAGRVEMFYMGSWATVCD
DSWDMADGEVVCRQMGCGNAVSIHGNAHFGQGSGQILLDNVNCKGSESFLWDCPNAGLEK
HNCNHGEDAGVTCSGTSKTMKLVNGTNSCAGRVEILYMRSWATVCDDSWGMADAEVVCRQ
MGCGKAVSIHGNAHFGQGSGSILLDEVKCKGSESFLWDCPNAGLEKHNCKHPEDAGVTCS
DAIPKTIKLVNGTNSCAGRVEILYMGSWATVCDNSWDMADGEVVCRQTGCGNAVSIHGNA
HFGQGSGSILLDNVKCKGNESFLWDCPNAGLEKHNCQHSEDAGVTCSDAIPQKMKLVNGT
NSCAGRVEIHYMGSWRTVCDNSWDMADGEVVCRQMGCGNAVSIHGNASFGQGNGPILLNE
SEMQRQ
Download sequence
Identical sequences B5DEE3
NP_001135689.1.99540 gi|197245687|gb|AAI68636| gi|213983061|ref|NP_001135689|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]