SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|197246317|gb|AAI68488| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197246317|gb|AAI68488|
Domain Number 1 Region: 596-802
Classification Level Classification E-value
Superfamily Fibronectin type III 2.81e-34
Family Fibronectin type III 0.00055
Further Details:      
 
Domain Number 2 Region: 805-990
Classification Level Classification E-value
Superfamily Fibronectin type III 3.1e-25
Family Fibronectin type III 0.0000431
Further Details:      
 
Domain Number 3 Region: 310-403
Classification Level Classification E-value
Superfamily Immunoglobulin 1.17e-22
Family I set domains 0.00061
Further Details:      
 
Domain Number 4 Region: 421-505
Classification Level Classification E-value
Superfamily Immunoglobulin 8.86e-22
Family I set domains 0.04
Further Details:      
 
Domain Number 5 Region: 224-320
Classification Level Classification E-value
Superfamily Immunoglobulin 1.05e-19
Family I set domains 0.0019
Further Details:      
 
Domain Number 6 Region: 498-601
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-17
Family I set domains 0.046
Further Details:      
 
Domain Number 7 Region: 22-114
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000576
Family I set domains 0.0025
Further Details:      
 
Domain Number 8 Region: 123-205
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000021
Family I set domains 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|197246317|gb|AAI68488|
Sequence length 1028
Comment Unknown (protein for MGC:172944) [Xenopus (Silurana) tropicalis]
Sequence
MRLLWKLLAFPWLVCLADELTLQGPVFTQEPPNINFPLDSEDRTLRLVCEVQGHPKPVVR
WRVNGTLMDEAQDYRYRVLDRSLIIASPDRNRDVGTFQCEATNSLGTILSREAYVQFSYL
DSFQTRTRSTVSVREGQGMVLLCGPPAHSGELVYAWIFNEYPPFVQQDNRRFVSQVTGNL
YIAKVEPSDAGNYTCVVTNTVTNTRELGPSTPLTLRTDGVMGEYEPKIEVHFPESVPSAK
GSTVKLECFALGNPVPTITWRRADGKPISRKVRRHRSSGVLEIPNFQQEDAGPYECVAEN
TRGKNMVRGQLTYFAPPTWVQKINDAHIAIEENILWECKASGRPKASYTWLKNGQRLQSK
GRLQIDHGSLTITSVNISDSGMYQCLAENKHGTIYSSAELRVIAVGPDFSKGFVKRVTLG
KVGGSVLIECKPKASPKPSITWKKGKELQRESSRISILDDGTLKISNLTKADAGSYTCTA
SNHFGTASSTGTLVVKDPTQVLVPPSSMDVTVGESIVLPCQVSHDHSLDISFSWVFNGQL
IDFQKDGEHFERVGGQDSAGDLMIRSIQLKHAGKYICLVHTSVDKLSAGADLIVRGPPGP
PDALTVEEITDTTAQLSWMPGVDNHSPIIMYSVQARTPFSVGWQAVSTVPEVVDGRSFTA
TVVGLSPWVEYEFRVIAINEIGIGEPSPPSDKRRTEEALPEVTPANVSGGGGSKGELVIT
WEPVPEELQNGGGFGYVVAFRPFGTISWMQTVVASADSSRYVYRNESLPPFSPYEVKVGV
YNNRGEGPFSPLTVVYSAEEEPGRAPAGVFSRSLTAWDIEVSWIAVPGSLSKGRIQGYEV
RYWKQNEKEQNARKLRTLGNQTSTKLSHLQGHTLYHLNVRAYNSAGTGPASTTVNVTTRK
PPPSQPPGNIIWNSSNSKIILNWDQVTAQEDESEVKGYRVLYRWNRPGGASVIETNQTSV
ELSLPYDEDYIIEIRSISEGGEGSSSEPIRIPRISNAYAQGSGASTSNACTLSAISTLMI
SLTARSSL
Download sequence
Identical sequences B5DE14
gi|197246317|gb|AAI68488| gi|213982949|ref|NP_001135636| NP_001135636.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]