SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|213624032|gb|AAI70561| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|213624032|gb|AAI70561|
Domain Number 1 Region: 163-271
Classification Level Classification E-value
Superfamily C-type lectin-like 1.22e-38
Family Link domain 0.0027
Further Details:      
 
Domain Number 2 Region: 276-358
Classification Level Classification E-value
Superfamily C-type lectin-like 5.57e-26
Family Link domain 0.0012
Further Details:      
 
Domain Number 3 Region: 51-162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000696
Family V set domains (antibody variable domain-like) 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|213624032|gb|AAI70561|
Sequence length 359
Comment ubiquitin specific peptidase 12 [Xenopus (Silurana) tropicalis]
Sequence
MLAELSMILLVASVCRGLPFYNGFYYEHILNNKTNNGNGEVIHFNGVRLVVNTPDDSLFG
YRGGNVTLPCTFHYEPKLNSTRRFRVKWSKLHNDNTKERDVLVAIGLRHRSFGEYKGRVH
LIQNQPNEVSMVITDLRLEDYGKYKCEVIDGLEDESGIVELELRGVVYPYQPPHGRYQLN
FHDAKKACEDQDAMMASFEQLFKAWEEGLDWCNAGWLMDGTVQYPVTLPREPCGGKDTAP
GVRSYGERHKHLHRFDAFCFSSALKGKVYYLEYPERMTFAEAKAACQDDGAQIAKVGQLF
AAWKFIDLDRCDAGWLDDGSVRYPIASPRPNCGPPEPGVRSFGFPARYMKFGVYCYKMS
Download sequence
Identical sequences Q28ET6
NP_001016048.1.99540 XP_012814443.1.99540 gi|213624032|gb|AAI70561| gi|213624034|gb|AAI70563| gi|62860278|ref|NP_001016048| gi|89269891|gb|CAJ83435|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]