SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|213627788|gb|AAI71123| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|213627788|gb|AAI71123|
Domain Number 1 Region: 175-581
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.09e-84
Family L-arabinose binding protein-like 0.00079
Further Details:      
 
Domain Number 2 Region: 104-157
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000417
Family Complement control module/SCR domain 0.00064
Further Details:      
 
Domain Number 3 Region: 51-99
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000181
Family Complement control module/SCR domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|213627788|gb|AAI71123|
Sequence length 987
Comment Unknown (protein for MGC:197850) [Xenopus (Silurana) tropicalis]
Sequence
MCRSITLLFALWLTPVFGSGQSNTTGCRIIHPPRDGGIRYRGLTLTQVKAVEVLPVDYEI
EFVCRGEREISGPKVRKCQRNGTWTDMDKPSRCLHTCSRMHLKLENGRADVRGMGRVPME
GTSVQFACDPGFLLVGSSHSLCTKSGKWDHPKPICQVRRPDTSIRHPESSRKRALHVGAL
FPMSGGWPGGQACQPAAQMALEDVNNRRDILPEYELRLIHHDSQCDPGQATRYLYELLYN
DPIKIMLMPGCSSVSTLVAEAARMWHLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNP
TRVQLFKKWGWTKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAIPVKNLK
RQDARVIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIPDPAINCTVEEM
TQAVEGHVTTEIVMLNPENTRGISNMTSQEFMEKLKKRLGENPEMTGGLQEAPLAYDAIW
ALALALNKTAYELSKKGRRLEDFNYNNKMISEEIYRAMNSSSFDGVSGHVVFDASGSRMA
WTLIEQLQGGVYKKIGYYDSTKDNLSWYNNDKWIGGSPPADHTKVIITFRYVSQKLFISV
SVLAGLGILLGFVCLSFNIYNSHVRYIQNSQPHLNDVTAAGCILSLAAVFPLGLDGRHIE
TWHFPLVCQARLWLLGLGFSLAYGSMFTKIWWIHTAFTKKDDKKERRKQSQTLEPWKLYT
TVSLLLGLDVITLGIWQIVDPLQRSIEEFTKEEPRGDLDVLILPQLEHCSSLKMNTWLGI
VYGSKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDA
SFAFSSLAIVFSAYITLVVLFVPKMRRLITRGEWQSEQQDTLKTGSSTNNNEEEKSRLLE
RENQELGRIIAEKEERVMELRQQLRSRRRPSVPARDNCSDNHFPNSSGAVSSLYQPGLPL
ARCLVAEGGDKLGRNSCDGSRVHLLYK
Download sequence
Identical sequences B7ZU67
gi|213627788|gb|AAI71123| XP_012823396.1.99540 XP_012823397.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]