SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|213982803|ref|NP_001135573| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|213982803|ref|NP_001135573|
Domain Number 1 Region: 210-236
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000454
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 
Weak hits

Sequence:  gi|213982803|ref|NP_001135573|
Domain Number - Region: 37-69
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0107
Family Mitotic arrest deficient-like 1, Mad1 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|213982803|ref|NP_001135573|
Sequence length 709
Comment zinc finger, CCHC domain containing 8 [Xenopus (Silurana) tropicalis]
Sequence
MAEVDFGDIELFEQLDGDLPATSVHVRFENDSEGENNVLKELVAQHEETINQLRAENEKL
KRKLSLLNRPSGLPVEDKLEGPLLQILFMNHTVSKQYHQEIEEFITSLSQKYEEHQKSNS
EKTSFNIKPQPSSIQLEENDHSGSETVKKSKEAFCVVGSVQYFKNFCLDKLGQPLLNENP
QLTDGWDIPKYQQVFTQIVSLDGQEIQVKSKRPKPCCFNCGSEEHQMRDCPKPRDQAHIT
KKRKEFMDACGEAGNQNQQRYHAEGVEERFGKYKPGVISEELQEALGITEKNFPPFIYRM
RELGYPPGWLKEAELENSGLALYDGKDTSDGEIEERDTEGKKHVSYDVSKLVNYPGFNIS
APPGMFDDWQMFGSIPMQPAHQKDIFATYLTTTFPSQSPNNSNKRSACQSSSSERKRQKT
SGNHTVTSAVDMDMESDEEMYRSRHLKGYTFQPPLPPGSPSYGTPPPLPRGTPPSTPPNF
IPPPPPTPTPPPLPKGTPPPTPNRDSPKVPPQVLDEDTWTLEELEEKQRLLWAQLDNAES
TNSDCDAHTPITGSSVTSSPSRTDLDIVTRCKAASQQPANEFKTPCGISKSFVPESEEAS
LLITEEDSEANEDSNECYVAEGNDIEEHKLSPNHEKTSEKNQADEYATEEAACVEPSPKM
SGVPDMSKFAEGITPFEYDNMSDSTGVYLRLRSVLKNSPRNQQKSKKQV
Download sequence
Identical sequences B4F702
gi|195540002|gb|AAI68078| gi|213982803|ref|NP_001135573| NP_001135573.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]