SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|213983015|ref|NP_001135668| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|213983015|ref|NP_001135668|
Domain Number 1 Region: 29-113,167-421,513-572,601-624
Classification Level Classification E-value
Superfamily MFS general substrate transporter 7.46e-35
Family LacY-like proton/sugar symporter 0.039
Further Details:      
 
Domain Number 2 Region: 433-485
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000735
Family Ovomucoid domain III-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|213983015|ref|NP_001135668|
Sequence length 637
Comment solute carrier organic anion transporter family, member 2A1 [Xenopus (Silurana) tropicalis]
Sequence
MGIKLVDSKADSKSITGCKKGIFNNIKVFVVCHALLQLSQLLYSAYFKSCLTTIEKRFGL
SSSSSGLLSSIHEISNAVLIIFVSYFGSRVHRPRVIGVGGLLLALGTFLLTVPHFVSEKY
QYTELNSGNRSQVLLCTGENRTFHCKTQGQHLPVTTNNGGSSMWAIMVVGQLLAGIGTVP
IQPFGISYVDDFAEPNNSALYIAILFAVAVFGPAFGYLLGSVVLRMFVDIGRVNLEHVDL
TVADPRWIGAWWLGLLIASGCLVITSIPYFFFPKQMLRNEKPAPEENVLRKIPDVKAEEG
SLSDFIKKFPRYVRRLITNPLFLMLVLCQCSFSSVIAALSTFLNKYLEKQYSSSTSYANF
LIGAVNLPTAALGMLIGGIIMKRFCISLQIIPRFALAILLLSILLCVPLFFMGCSTQALE
MGMVEHSTSGNTLSTCTSQCACPEYAFQPVCGSNGVEYLSPCHAGCRAFNQTSSEKLRMY
RNCSCITDTSGEGTAQTGSCPTSCSHLLLPVMFLISFAGLIACLTHNPLYMMVLRVVRQD
EKSFAIGVQFLLMRFLAWLPAPALFGLVIDSTCLVWDRSCSGNRGACRYYNNDLLRNRYL
GLQMGYKILGILLLCAIAWKVSKRKEYNVQEKESGMA
Download sequence
Identical sequences B5DE94
8364.ENSXETP00000025839 ENSXETP00000025839 gi|197246709|gb|AAI68578| gi|213983015|ref|NP_001135668| ENSXETP00000025839 NP_001135668.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]