SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|224493162|gb|A0JP86| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|224493162|gb|A0JP86|
Domain Number 1 Region: 707-758
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000949
Family Laminin-type module 0.0083
Further Details:      
 
Domain Number 2 Region: 269-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000184
Family Laminin-type module 0.043
Further Details:      
 
Domain Number 3 Region: 811-864
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000198
Family Laminin-type module 0.00019
Further Details:      
 
Domain Number 4 Region: 918-968
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 5 Region: 867-915
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000893
Family Laminin-type module 0.00049
Further Details:      
 
Domain Number 6 Region: 1323-1571
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000111
Family Tropomyosin 0.0052
Further Details:      
 
Domain Number 7 Region: 381-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family Laminin-type module 0.0064
Further Details:      
 
Domain Number 8 Region: 430-480
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000179
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 9 Region: 756-813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000678
Family Laminin-type module 0.0002
Further Details:      
 
Domain Number 10 Region: 325-383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000949
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 11 Region: 1053-1284
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000575
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0063
Further Details:      
 
Domain Number 12 Region: 966-1011
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000921
Family Laminin-type module 0.012
Further Details:      
 
Weak hits

Sequence:  gi|224493162|gb|A0JP86|
Domain Number - Region: 670-709
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00151
Family Laminin-type module 0.056
Further Details:      
 
Domain Number - Region: 83-163
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0147
Family Galactose-binding domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|224493162|gb|A0JP86|
Sequence length 1592
Comment RecName: Full=Laminin subunit gamma-1; Flags: Precursor
Sequence
MRAPVLAVLAVLLLGTVRAAMDECYEEGSPQRCMPEFVNAAFNATVVATNTCGTPPEEYC
VQTGVTGVTKSCHICDSGQFHLQHGAEYLTDYNNQAEITWWQSQTMLAGIQYPSTINLTL
HLGKAFDITYVRLKFHTSRPESFALYKRTHEDGPWIPYQYYSGSCEKTYQKFNRGFIRTG
EDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLN
TFGDEVFSDPKVLKSYYYAISDFAVGGRCKCNGHASECVRNEFEKIVCNCKHNTFGSDCE
KCLPFYNDRPWRRSTADSPNECLPCNCNGRSQECYFDPELYRSTGHGGHCTGCADNTDGP
NCERCRENYYRQDNNEPCHACQCNPVGSLSTQCDNYGRCSCKPGVMGEKCDRCQPGFHSL
TEAGCRPCACNPAGSTDECNVETGRCSCKDNVEGFNCERCKPGFFHLDEANPRGCTPCFC
YGHSSVCSSAEGYRVSSIVSTFESGVEGWTAQQRDGSEYSLSWVSDSSAVSVISESYFPI
YFIAPAKFLGNQGASYGQNLTFSFRVERRDTRLSAEDLVLEGAGLRVSVPLIAQGNSYPS
ETTQRYIFRMHEATDYPWRPSVSPFEFQKMLQNLTAIKIRGSYSERSAGFLEEVSLVTAV
AGAGPSAPWVEICSCPTGYIGQFCERCAPGYRRENPSQGPYSPCVLCTCNGHSDTCDPES
GVCDCQHNTAGPHCERCSEGYYGDSTTGSASDCQPCPCPGGSSCAVVPRTKEVVCTNCPL
GTTGKRCELCDDGYFGDPLGENGAPRPCRICECSNNIDPNAVGNCDRLTGECLKCIYNTG
GFYCDRCRDGFYGNPLAQNPDLKCRACSCNPYGTVKGQSGCNQVTGQCECLPHVTERDCS
ACEPGFYNLLSGRGCERCDCHSLGSTSGQCDVRTGQCECHPGISGQQCQQCEPNHFGFGP
EGCKPCDCDPEGSGSLQCKEDGRCECKSGFVGTRCDQCEENYFYNRSGPGCQECPACYRL
VKDKVNEQRGKLQELEDLLKNLSTGEENITDQAFEERLREAEKAVNDLLLDAQSSKDVDQ
GMLDRLAEINTTLSFQLERLQNIRDMIRDTDKQAQEARDRVENTEFIIDSARVQLEKAKM
AIANVSITPPESTGDPNNMTLLAEEARKLAERHMQEARDIEKAAKEANDTANEALRLLQK
TLASENQTALDIEELNRKYAQAKDIARELEKQASKVHAEAEEAGNRALQIYANLTSVPSI
DTTALQNEADKIQKEAEELDSLIDRKLRDYEDLREDMRGREMEVKNLLDKGKTEQQTADQ
LLARADAAKAQAEEAAKKGRETLQEANDILNKLRDFDKRVNDNKTAAEAALRKIPMIAQT
IAEANNKTRQAESALGNANADARGAKSKAEEAEALANTVQKKAATARAEADNTFKEVTDL
DGELQDMLQQLQEAENQLKKKQAEAESDEKMAEMASNATKDAESNANNSKKSVNGVLATI
DELLSRLGQLDSVDVGQLTVLEKTLDDAKNQLRDSDLDRKLAELQESSNLQRVALDSYSR
DIDQILRDIANLEDIKNTLPAGCYNTPIIEKP
Download sequence
Identical sequences A0JP86
NP_001090659.1.99540 gi|117558099|gb|AAI27298| gi|147899718|ref|NP_001090659| gi|224493162|gb|A0JP86|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]