SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|237512853|gb|BAH58779| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|237512853|gb|BAH58779|
Domain Number 1 Region: 89-160
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.61e-16
Family Complement control module/SCR domain 0.00074
Further Details:      
 
Domain Number 2 Region: 143-208
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000389
Family Complement control module/SCR domain 0.00056
Further Details:      
 
Domain Number 3 Region: 206-268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000709
Family Complement control module/SCR domain 0.00086
Further Details:      
 
Domain Number 4 Region: 29-100
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000031
Family Complement control module/SCR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|237512853|gb|BAH58779|
Sequence length 328
Comment ARC2 [Xenopus (Silurana) tropicalis]
Sequence
MFPYCSIRHVTALFLLYLVSSLAGVEGACDPPPRLSYADAKLDSVNTYENGSKINYDCLP
GYRSIPGTIRYVTCLGSTWSNPPTFCEVVKCRNPGEIQNGQIEEPINQSFGSRVVFKCNT
GYRMLSKLNYRDCQSNGEWSNDVPKCEAQVCPPPTAITDGDFSPQKDEYSYQDSVTFKCN
KDLALVGSTSLFCTAHGNWSSDEPNCKDVVCEYPHVENGQKISGLRGPYKLNYAVTFKCD
NGFELTGPQTITCTVDNIWEPPLPECRRKDKEGTENAEKPGNVGVIVGAIFGVLAVGAAV
GGSVYYFIIKKRKPKTDSPRAHYSNVSN
Download sequence
Identical sequences C4B802
NP_001156329.1.99540 XP_012820199.1.99540 XP_017946819.1.99540 gi|237512853|gb|BAH58779| gi|242247017|ref|NP_001156329|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]