SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257096544|gb|A4IIA2| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257096544|gb|A4IIA2|
Domain Number 1 Region: 182-269
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.06e-23
Family Thyroglobulin type-1 domain 0.00019
Further Details:      
 
Domain Number 2 Region: 24-108
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.18e-22
Family Growth factor receptor domain 0.0000978
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257096544|gb|A4IIA2|
Sequence length 284
Comment RecName: Full=Insulin-like growth factor-binding protein 2; Short=IGF-binding protein 2; Short=IGFBP-2; Flags: Precursor
Sequence
MGLSRYLLGLLLGVLCTPAPAEVLFRCPPCSPERLATCPGSAPRPPCAELVRAPGCGCCP
VCARLEGESCGVYTARCAGGLRCYPHPGSELPLQALVLGLGTCGKRRDTEYGSSQERGTE
LPEERSDNMLVDNKLEAGPAVAGEAAPRKPSKKEMKEIAVTRERANEQQRSKSNKSEDKK
RPARSLCQLQLDQVLERISGMHLPDDRGPLEHLYALHIPNCDKNGFFNLKQCKMSVNGQR
GECWCVNPITGKALPGSPTIRGDPECHLYYTSPEEGRAHTQRAP
Download sequence
Identical sequences A4IIA2
gi|134026148|gb|AAI35929| gi|154147617|ref|NP_001093707| gi|257096544|gb|A4IIA2| NP_001093707.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]