SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|288684088|ref|NP_001165761| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288684088|ref|NP_001165761|
Domain Number 1 Region: 96-192
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-23
Family HtrA-like serine proteases 0.00016
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.1e-22
Family Prokaryotic proteases 0.0000841
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|288684088|ref|NP_001165761|
Sequence length 195
Comment serine protease [Xenopus (Silurana) tropicalis]
Sequence
MGSPFSLKNTITSGIVSSAQRGSKELGLSNSNMDYIQTDATIDFGNSGGPLINLDGEVIG
INTMKVTAGISFAIPLFLDRSADKQKSWFGESGWKRRYIGVMMLTLTPSIIEELRMRDPS
FPDVSHGVLIHRVIVGSPANRAGMKPGDNIIEINGVKVNTSEEIYNAVRTSESLNVVVRR
GADLLMLHMTPESTV
Download sequence
Identical sequences A7YYA4
gi|163915732|gb|AAI57581| gi|288684088|ref|NP_001165761| NP_001103640.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]