SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|288684101|ref|NP_001165762| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288684101|ref|NP_001165762|
Domain Number 1 Region: 3-157
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.58e-43
Family Prokaryotic proteases 0.00000205
Further Details:      
 
Domain Number 2 Region: 167-263
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-22
Family HtrA-like serine proteases 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|288684101|ref|NP_001165762|
Sequence length 266
Comment serine protease [Xenopus (Silurana) tropicalis]
Sequence
MTNAHVVVNKRGVRVKLTNGETYSATVQDVDQAADIATIKINVKNPLPALRLGKSSDVRQ
GEFVVAMGSPFSLKNTITSGIVSSAQRGSKELGLSNSNMDYIQTDATIDFGNSGGPLINL
DGEVIGINTMKVTAGISFAIPSDRVCLFLDRSADKQKSWFGESGWKRRYIGVMMLTLTPS
IIEELRMRDPSFPDVSHGVLIHRVIVGSPANRAGMKPGDVIIEIDGVKVNTSEEIYNAVR
TIESLNVVVRRGADLLMLHMTPESTE
Download sequence
Identical sequences A7MC76
NP_001103998.1.45394 gi|169642095|gb|AAI60801| gi|288684101|ref|NP_001165762|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]