SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301079075|gb|ADK56767| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301079075|gb|ADK56767|
Domain Number 1 Region: 240-438
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.59e-47
Family Reprolysin-like 0.00028
Further Details:      
 
Domain Number 2 Region: 455-531
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 2.57e-19
Family Blood coagulation inhibitor (disintegrin) 0.00048
Further Details:      
 
Weak hits

Sequence:  gi|301079075|gb|ADK56767|
Domain Number - Region: 677-715
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family Integrin beta EGF-like domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301079075|gb|ADK56767|
Sequence length 918
Comment metalloproteinase ADAM22 isoform 2 [Xenopus (Silurana) tropicalis]
Sequence
MHIKGGRLASWICCVIGSIHLAHGSTRAGNGWMTGTQRKKENNVLGMEDTVPLRLIFTNE
VDNQTTQGLLSTRVRAGSPHHQDQLTHVARASFQIDAFGSSFILDVELNHDLLSSEYRER
HVTQDGKTVEFKGGEHCYYQGQIRGKAKSFVALSTCYGLHGMFCDGNHTYLIEPREKYNP
NEDYQFHSVYKSKVLEFPIDELPSEFWPLNDTSPRLSQQTRNQRKKRQTRRYPRNVEDET
KYVELMIVNDHLMYKKHRLSVGHTNSYAKSVVNMADLIYKEQLNTRIVLVAMETWATDNK
FSISENPLLTLKEFMKYRRDFIKDKSDAVHLFSGSQFESSRSGAAYIGGVCSLLKGGGVN
EFGKPDVMAVTLAQSLAHNLGIFSDKKKLLSGECKCEDTWSGCIMGDIGYYLPSKFSVCN
IEEYHEFLNNGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGTIAECAVEGGECCKKCT
LTQDSECSDGLCCSDCKFNPKEMICREAVNDCDIPETCTGNSSQCPANIHKLDGYQCESM
QGLCFGGRCKTRERQCKYIWGEKVSAADKYCYEKLNIEGTEKGNCGRNKETWIQCNKQDV
LCGYLLCTNISSVPRLGELDGDVTTSSVVNQGKLYNCSGGHVKLDEDTDLGYVEDGTPCG
TGMMCLEHRCLPIDSFNFSTCLGSTNKICSGHGVCSNEVKCICDSFWTGDDCSNFLPYDG
IIKPDEGHRDEGVISTNIIIGAIAGTILVLALVLGITAWGYKNYRRERQIPQGDYVKKPG
DADSFYSDLPPGVSSNSASSSKKRSAILSHFQISACSIPHYSISQNISLFCRRSNGLSHS
WSERIPDTKHVSDVCENGRPRSNSWQGNVSSSRKKLRGKRFRPRSNSTDLGSKQILLRKI
LDSHGSNKMCIWCIPTFK
Download sequence
Identical sequences E2ICL9
gi|301079075|gb|ADK56767|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]