SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301604342|gb|XP_002931822| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301604342|gb|XP_002931822|
Domain Number 1 Region: 655-946
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-83
Family Protein kinases, catalytic subunit 0.00000000221
Further Details:      
 
Domain Number 2 Region: 85-239
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.32e-62
Family Ephrin receptor ligand binding domain 0.0000039
Further Details:      
 
Domain Number 3 Region: 364-566
Classification Level Classification E-value
Superfamily Fibronectin type III 1.65e-32
Family Fibronectin type III 0.00014
Further Details:      
 
Domain Number 4 Region: 949-1020
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.2e-20
Family SAM (sterile alpha motif) domain 0.00049
Further Details:      
 
Domain Number 5 Region: 290-355
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000218
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301604342|gb|XP_002931822|
Sequence length 1025
Comment PREDICTED: LOW QUALITY PROTEIN: ephrin type-A receptor 6-like [Xenopus (Silurana) tropicalis]
Sequence
mgkwdwrtvlektvlllsivgsfrvgsnhlsdnqglnvvllxxsgllicgleaeigergl
etwrekgkdcwlkyvcmyftnnmyspcsqwdaitemdeynrpihtyqvcnvmeanqnnwl
rtnwisrdaaqkvfvemkftlrdcnsipwvvgtcketfnlhymesddahavkfkptqysk
idtiaadesftqmdlgdrilklntevrevgpitkkgfylafqdigacialvsvrvyykkc
pymvrnlamfpdtiprvdssslvevrgscikyaeerdtpklycgadgdwlvplgrcvcsi
gyeevdgschacrpgfyksfagnikcskcpphsftyaeattvcqcekgfyraekdppsma
ctkppsaprnvnfnmnetalylewsppidtggrkdvvynvlckkcdpsqcelcgggiryv
pahsglqnasvtvldflshvnytfdieatngvselsflpkpytsimittdqeapsligmv
rkdwasqnsialswqepdypkglivdyeikyyekeheqlsysstrskapsviitglkpat
kyifhirvrttagysayshkfefetgdetsdlaaeqgqilviataavggftllviltlff
litgrcqwyikakmkseekrranlqnghlqfpgvktyidpdtyedpslavhefakeidps
ririervigagefgevcsgrlktpakkeipvaiktlkggyvdrqrkdflreasimgqfdh
pniirlegvvtksrpvmivveymengsldsflrkhdgqftviqlvgmlrgiasgmkylsd
mgyvhrdlaarnilvnsnlvckvsdfglsrvleddpdaaytttggkipirwtapeaiafr
kfssasdawsygivmwevmsygerpywemsnqdvilsieegyrlpapmgcpvslhqlmlh
cwqkdrnirpkfsdivgfldklirnpsalhilvedilgmpespgdapeyhfvvtvsewle
sikmgqyahnfmasgfttldmvsrmtiddirrigitlighqrrivtsiqtlrlqimhiqe
kgfhv
Download sequence
Identical sequences gi|301604342|gb|XP_002931822|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]