SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301604379|gb|XP_002931868| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301604379|gb|XP_002931868|
Domain Number 1 Region: 1248-1588
Classification Level Classification E-value
Superfamily NHL repeat 3.4e-26
Family NHL repeat 0.0032
Further Details:      
 
Domain Number 2 Region: 1428-1794
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000000186
Family DPP6 N-terminal domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 944-1016
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000255
Family Carboxypeptidase regulatory domain 0.047
Further Details:      
 
Domain Number 4 Region: 686-712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000977
Family Integrin beta EGF-like domains 0.076
Further Details:      
 
Weak hits

Sequence:  gi|301604379|gb|XP_002931868|
Domain Number - Region: 783-809
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0003
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 655-679
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.069
Further Details:      
 
Domain Number - Region: 620-647
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00265
Family Integrin beta EGF-like domains 0.064
Further Details:      
 
Domain Number - Region: 754-778
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00328
Family EGF-type module 0.068
Further Details:      
 
Domain Number - Region: 819-858
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family EGF-type module 0.071
Further Details:      
 
Domain Number - Region: 187-244,271-325
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0445
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 
Domain Number - Region: 590-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0656
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301604379|gb|XP_002931868|
Sequence length 2787
Comment PREDICTED: teneurin-1-like [Xenopus (Silurana) tropicalis]
Sequence
meqmdskpyqplskvkhemdltytsssedsedeqkprqsynsretlqectqeirlnynsh
ssrkrkavddpsqemefcetphiicsgyqtnlhsisqhgyplemgsdvdteteavspdra
lrmwmremksehssclssransalsltdtdherksdgengniashkkiyyvnavhfsvfg
hlddipasprnqftfrplppppppphactcsrqtsqtldtlqrssmtscsqpspaasnpp
gvtqdsvhlhnswvlnsnipletrnflfratlnlpqalekkipasprnqftfrplppppp
pphactcsrqtsqtldtlqrssmtscsqpspaasnppgvtqdsvhlhnswkskwakneff
ekclrllhpwspfclflsyffisgginlcsffiavhlfgltwqlqpvegplyengvskgs
rseestdttfsplggkvsdkaekkvyqrgkaidsgeidigkqiiqtippglfwrfqimih
hplylkfnvslakdsllgiygrrnippthtqfdfvklmdgkhlikqepkntenpqhaprs
lilaslqetgfieymdqgawhlafyndgkkmeqvlvlttaiemmddcstncngngecisg
hchcfpgflgpdcardscpvlcsgngeyekghcvcrngwkgaecdvpeeqcidptcfghg
tcimgvcicvpgykgeiceeedcidpmcsghgvcvqgechcsagwggvncetvlalcqeq
csghgtfllesgtcsceprwtgsdcstelcsvdcgshgtcsggvckcedgwggascdert
chpicaehglckdgkcecspgwegeqctiaqyldavrdgcpglcygngrctldqngwhcl
ckvgwsgpgcniimemlcadnldndedgltdcvdpdccqqvncfssplcqgspdpldliq
qsqppfsqhpprlfydrikfligkdsthvlpgemtvdssracvirgqvvavdgtplvgvn
vsflhhsdyghtisrqdgsfdlvtiggisvtllferspfvsvkrtlwlpwnkyivvekvv
mqrietetplcdmssfmspnpivlpsplttfaascpqrgsvipelqvaqeeipipsnflk
inylssralgykslvyiilthatipvglskvhltvavegrlvqkwfpaainlvytfawnk
tdiygqkvlglaealvsvgyeyesctdfvlwekrtvtlqgfemdasnlggwsfnkhhiln
pqngilhkgdgenvfisqqppvistlmgngqqrsiscsncngptsnsklfapvalatgpd
gslyvgdfnyvrriypsgntisvlelrnrdtrhstspahkyylavdpasellylsdtstr
rvykvkslsevkdlaknfevvagtgdqclpfdqshcgdglraheaslnsprgitvdghgf
vyfvdgtmirkiddrgvistiighngltstqplscdsgmdisrvrlewptdlavnpmdns
lyvldnnivlqitdnnrvriiagrpihcqvpgidyflvskvaihstlesaraiavshsgv
lfiaetderkinriqqvttngeistlvgapsdcdckidpncdcfsgdggfakdsklkaps
slavspdgmlyiadlgnirirgvsknkphlnpsniyevaspvdqelyqfstngthlhtln
litrdyvynftyngdgdissitksngnsvhirrdaggmplwlvvpggqvywltissngvl
krisaqgynlalmtyhgnsgllatksnengwttvyeydpdghltnatfptgevssfhsdm
ekatrveldtssrenivtttnisatstiyalrqennlntyrvnpdgslrvtfasgmeiml
naephtlagvvsptlgkcnislpgehspnliewrqrkeqnkgnisaferrlrahnrnlls
idfdhisrtgkiyddhrkftlrilydktghpiqwspsskyhdvnityspsglvnyiqrgp
wtemmeydqtgkivsrtwgdgkmwiysylektvslflhsqrryifeydhsdylasvtmpn
mmrhtlqtmlsvgyyrniysppdnggsfiqdfsrdgrllqtlhigtgrrvlykytkqtrl
seivydttqitftyeetsgviktihlmhegfvcairyrktgpligrqifrfseeglvnar
fdysynnfrvtsmqaminetplpidlyryvdvsgrieqfgkfsvinydlnqvitttmmkh
tkifsssgqvievqyeilkaiaywmtiqydsmgrmitcnirvgvdanitryfyeydadgq
lqtvsvndkpqwrysydlngninllshgnsarltplrydvgdritrlgeiqykmdedgfl
rqrgndifefnsngllskaynkvagwsvqyrydglgrrvasksnlgshlqffyadlanpm
rvthlynhssseitslyydlqghliamelssgeeyyvacdntgtplaaftsrgqiikeil
ytpygdiysdsnpsfevligfygglydsltklvhlgqrdydvvagrwatpnlriwnklni
dpkpfnlysfennypvgrtqdveqyttdigswlelfgfrlhnvlpgfpkpeskdfestye
lqqlqtqtqewdpgktvlgiqcelrkqlrnfisldqlpmaprqnegkyhaklnyprfaai
psvfgkgikfaikegtvtadvigvanedsrriaailnnarylenlhftiegrdthyfikl
gsleedlavignsgsgrilengvnvtvsqmtslvngrtrrfadiqlqhntlcfnvrygts
meeeknhvlelarqravaqawtkeqkrlqegeegirqwtetekqqllntgkvqgysgyfv
lsvdqylelsdnannihfmrqseigrr
Download sequence
Identical sequences gi|301604379|gb|XP_002931868|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]