SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301604824|gb|XP_002932067| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301604824|gb|XP_002932067|
Domain Number 1 Region: 421-609
Classification Level Classification E-value
Superfamily vWA-like 1.53e-47
Family Integrin A (or I) domain 0.00091
Further Details:      
 
Domain Number 2 Region: 813-992
Classification Level Classification E-value
Superfamily vWA-like 7.09e-46
Family Integrin A (or I) domain 0.00068
Further Details:      
 
Domain Number 3 Region: 234-404
Classification Level Classification E-value
Superfamily vWA-like 1.17e-43
Family Integrin A (or I) domain 0.00046
Further Details:      
 
Domain Number 4 Region: 30-209
Classification Level Classification E-value
Superfamily vWA-like 2.09e-43
Family Integrin A (or I) domain 0.00072
Further Details:      
 
Domain Number 5 Region: 1201-1392
Classification Level Classification E-value
Superfamily vWA-like 1.53e-39
Family Integrin A (or I) domain 0.002
Further Details:      
 
Domain Number 6 Region: 1414-1588
Classification Level Classification E-value
Superfamily vWA-like 2.52e-39
Family Integrin A (or I) domain 0.0014
Further Details:      
 
Domain Number 7 Region: 1004-1191
Classification Level Classification E-value
Superfamily vWA-like 1.95e-38
Family Integrin A (or I) domain 0.00072
Further Details:      
 
Domain Number 8 Region: 629-783
Classification Level Classification E-value
Superfamily vWA-like 5.56e-33
Family Integrin A (or I) domain 0.00081
Further Details:      
 
Domain Number 9 Region: 2167-2320
Classification Level Classification E-value
Superfamily vWA-like 7.23e-28
Family Integrin A (or I) domain 0.011
Further Details:      
 
Domain Number 10 Region: 2397-2586
Classification Level Classification E-value
Superfamily vWA-like 6.85e-26
Family Integrin A (or I) domain 0.003
Further Details:      
 
Domain Number 11 Region: 2810-2869
Classification Level Classification E-value
Superfamily BPTI-like 7.66e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00019
Further Details:      
 
Domain Number 12 Region: 1611-1815
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000223
Family Integrin A (or I) domain 0.026
Further Details:      
 
Weak hits

Sequence:  gi|301604824|gb|XP_002932067|
Domain Number - Region: 2681-2769
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0599
Family Fibronectin type III 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301604824|gb|XP_002932067|
Sequence length 2881
Comment PREDICTED: LOW QUALITY PROTEIN: collagen alpha-3(VI) chain-like [Xenopus (Silurana) tropicalis]
Sequence
mrergvlllvavfclmlsgmhrvdaqddsadlvflidgsnnvgrsdfsyirdflvnyvqr
rlevgrsrmqvgvvqysddvktefslaqnptkgqlvealknlrfiggeeanlgaaldyvv
envfttaagsrreegvpqslmiitagpssddfreatnalklnsiitfgigveradiaelq
qiatdesfvfstpqmqdlstlernivpyingvaqrtivlqppttitevvevnkrdivflv
dgssnlgsssftairdfinkvvnrleigpesiqvalaqyaqdvkpefylnsyttkkdvaa
qvkklkilnstplntgaalkyvqrnfftasagsrvgegvpqllvlitggpsrddigqvsh
elkrggiltftlgskraveselkeiafdstlafrvdefkalplqgilpqlltplktltgt
vveapapvnprdivflldgsvnvgsanfplvrdflinvinglgvssegtrvglaqfsdtp
rtefylnsltskpellnriaqlrlqggnalnigsaiqyvlenhftsgagsriqenvpqll
vmlaagkssdsiqsaaiqlvnsgvltfcigagnadkeelqriafnrqlvyetddfstlpq
lsqeiltplttyyrgpvtevtvttegkkdilimfdtanivgkyplvrdfltgitegfnig
pdatrvsvaqmggdsvkvefkfdtyptkqevlnavrrmrlrqsktldigsaldyarenlf
taesgsriregvpqylvlltagrsstgvdepadklrqagiitfavktsdadelgkmvftl
pvgaltdlstvhsqlintlntltvettvvtxdkrkdvvflidgtddarsrfpalrsfiqr
vvqnldvgqdktriavaqysdsarpnfqlnthrdkqgvldaiqrltpiggpslntgaald
fvtrnvftksagsrsdegvpqflillttgksrddvgrpatslkgqgvipfaigtnkadtt
elqtisfvpdftfsvsdasqltdvyqnfankvsqlskgeveiliqrgpsvttgakrdvvf
lvdgsrtamaefpqvkeligkivdrldvspdntrvsvvqysgdpkvefllnahstkdevl
aavrkirpkggnvvntggaleyvskniftrpagsrieervpqiliitssgpsaddvgega
rqvkesavvpfligknideeegnkivvarnfflpvtsfrelpaleqtlvnsfttltteqi
trlfethpdvdpdkkdvvflidgssktgqdgmahirdfilevvqnfqigpnkvrvglvqf
snepvsefflktnlqkqallnnirrlrlkggaplnigkaveyvaknqfvksagsrieegv
pqylvlltggkseddvsrsarllhnakvqsvavasgttdrkdietivtdtrlifnikefr
elpsverkiyrsfegeievtptpaitttiskkeadivflvdgsinlgrdnfkevlqfvsg
ivdavfdeedaiqialaqynsdvtdefflkdftdrdqimdavtkaeykggrvaslgaair
hlqdkhfvkeagsrvssgvpqiafvitggksvddgqsaamalsnkgvkvfaigvgaidgd
evakiasdapsafrvpnvqelselneqilitldtaltkkmtlcpsvpeiakdcklevilg
ydvsagpgqdvfmvqralqskikgilarisnmrniscsggqkpsvkvsvlsqgsrgpvea
fdfadyreellskilamgtrgpyvltgqtlqsyltkfktagedntikvvihmtdgvdagm
aelqaastalrnsgvkallfvglenvakfdqvrhlefgrgftydipltlsqetldfeiae
eldkiaekgccnvpckctgergdvgqpgdigpkgasglkghrgypgdeggpgergppgvn
gtqgfqgcpglrgpkgyrgfsgekgeigeigldgidgedgksgisgpsgergsqggrgek
gqkghrgeigdsgqrgdpgnpgtdttqrgskgakgetgavgepggdgsagspggpgkagp
agrrgppglkgergkdggrggageqgvrgpqgppgpqgtpgtrgeqglpgprgpggtpgp
agdrgrpgqlglkgepgdpgvkgangppgprgptgedgrdgsgkqglkgrrgetgfpgyp
glkgdfgdkgpngepgpkgnrgvrgvpgpkgtdgtkgdpgyqgpnglkgaigkprescel
vkyvkdkcpccygpkecplyptdlvfaldtssdvnrnvfanmkdallktisqlvitdsnc
prgarvalltynsdvttefrfsdglrkpallqeiqniqfkqttkqrnlegamsfvarntf
krarggflirkvavffsggatkaspqlneavlklydagvssvfltnredraltnalkvnn
tvvgqaivlsaapaqvnatvksllnchvcldicdpqstcpgssagstfrgrrsattdldi
dlaflldssesttpeqfaeikrfvshvvghlelstdpkssyhharisilqhapyehlnna
sipparvdvgltdytskeflqdfilnkmtqlygtrslnnaikyvqqhvlesapnprsirt
ifliltgevnshelkqlretvveakckgffivilslgkkvnvgqlnslssephdvfskka
ekpselhedtllrfglqlpgflssenafhlspeiqrqcdwfqndqpirtterethservt
ttvkpdetssqhpkvvtiltstetpieptilqqdaemptaelqvsnvsensatlnwtspv
sqksplydptlstleeqvvtlkqnateaeklneglenevkyqqlttviehnrtleqstsq
etftttskaqlspvalasaklvvnsetanspqttvvekalpapvlevntisgpevcnlqk
eegtcrdfvlkwyydpetkscarfwyggcggnenrfstqkecekicipvplnssvvsaig
t
Download sequence
Identical sequences gi|301604824|gb|XP_002932067|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]