SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301604968|gb|XP_002932133| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301604968|gb|XP_002932133|
Domain Number 1 Region: 608-718
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-25
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 2 Region: 435-542
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-21
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 3 Region: 725-790
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 262-377
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000209
Family Spermadhesin, CUB domain 0.0063
Further Details:      
 
Domain Number 5 Region: 852-911
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000655
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 784-846
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000001
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 376-437
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000135
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 8 Region: 547-613
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000737
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301604968|gb|XP_002932133|
Sequence length 1004
Comment PREDICTED: seizure 6-like protein-like [Xenopus (Silurana) tropicalis]
Sequence
msssevtvykplnyrkiepssrilkvhsdlkctyinitqkpsptspvelvphelvnnkis
kensqlketashsippsrelldperqsmlfhkevsevsstapnfsgtqtlptrkkppslk
qlntarkrlrpystslvserlaetsgsfsiptekiqgvkdilsetrearehipefslwvn
rrhsgtisqfpiqltpytsqpavphnseslklpssdintslqadepfrtryadndlntge
enqetttstiitttvittdqspvqcsvnffepegyidstdypplpsqnylectynitvym
gygvelqvksvnlsvgeqlairgegeeglvvlanetllvegqvirsptnrlsvhfrtfqd
daigtfqlhyqifmlscsfprrpdygdvtvmdlhaggkadfhcnmgyelqgsknltclna
skprwsdkepvciapcggrvqnatvgrvlspnypsnysnnlfcawtidafsgqklhlhfe
klilshkdrlavysngkilfdsaktetvpfeglisegsciriefstdesknapgfnvrfe
aferghcyepyiqngnftttdptysmgtvieftcdpghsleqgpaiiecinmkdpywndt
epvcramcggelstpagvilspnwpdlytegedciwrihvgddrrifldiqllnlssndi
ltiydgdeitskilgqftgnsgpqklyssspdlsiqfhsdpagliygkgqgfiinyievs
rndscsdlpeiqngwkttshtdlvrgakityqcdpgydivgsetltcqwdlswssdppfc
ekimyctdpgevehstrlisdpvllvgttiqytcntgfvlegsslltcysretgtpiwts
riphcvseeslacdnpglpengyqilykrlylpgesltfmcyegfelmgevtikcilgqp
sqwsgplpmckatqdrfehalqvaeaaaetsleggnmalaifipvviisvllggayiyit
rcryysslrlplmyshpysqitvetefdnpiyetgetreyevsi
Download sequence
Identical sequences gi|301604968|gb|XP_002932133|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]