SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301605081|gb|XP_002932179| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301605081|gb|XP_002932179|
Domain Number 1 Region: 105-170
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000306
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 285-350
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000473
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 45-110
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000005
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 228-297
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000723
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 345-410
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000764
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 6 Region: 165-230
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000764
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 7 Region: 405-471
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000473
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 8 Region: 4-54
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000567
Family Complement control module/SCR domain 0.00092
Further Details:      
 
Domain Number 9 Region: 553-604
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000375
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 10 Region: 486-545
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000431
Family Complement control module/SCR domain 0.0034
Further Details:      
 
Domain Number 11 Region: 607-672
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000162
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301605081|gb|XP_002932179|
Sequence length 677
Comment PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Xenopus (Silurana) tropicalis]
Sequence
mdtnifpigsvvryecrpgymkipmkkytaeclanatwskpdefcksvnclipmvpnskk
lsasmgpyklndivrfecvegfamqgsdtitcgvdsqwkpqipsclrvncsipmvpnskk
lsasmgpyklndivrfecvegfamqgsdtitcgidsqwkpqipsclrvnclipmvpnskk
lsasmgpyklndivrfecvegfamqgsdtitcgvdsqwkpqipsclrvncsipmvpnskk
lsasmgpyklnnivrfecvegfamqgsdtitcgvdsqwkpqipsclrvncsipmvpnskk
lsasmgpyklnnivrfecvegfamqgsdtitcnidsqwkpqipsclrvnclipmvpnskk
lsasmgpyklndivrfecvegfamqgsdtitcgvdsqwkpqipsclrvncsipmvpnskk
lsasmgpyklndivrfecvegfsikgfdtitcgvdsqwkpqipsclreacpepivphgii
rkqenvlngtsgsegysvgqlvkiecdlhyglnghniltcgsdllwypnipvcqpkhfcp
epkvfhgqiingtpvylrngiekgykvgdviklkcdpkhhlkgknsifcgsdmkwhprip
icehrlgcsypeiknglivlrngdtynpelnfsfflgdtvqvkckpgfamygnerskcgg
yfewspdlpicvqgnkq
Download sequence
Identical sequences gi|301605081|gb|XP_002932179|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]