SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301605142|gb|XP_002932214| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301605142|gb|XP_002932214|
Domain Number 1 Region: 251-315
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.88e-16
Family Complement control module/SCR domain 0.0085
Further Details:      
 
Domain Number 2 Region: 124-187
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.011
Further Details:      
 
Domain Number 3 Region: 65-121
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000057
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 194-254
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000167
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 5 Region: 376-434
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000634
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 6 Region: 438-501
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000236
Family Complement control module/SCR domain 0.0061
Further Details:      
 
Domain Number 7 Region: 568-629
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000137
Family Complement control module/SCR domain 0.0051
Further Details:      
 
Domain Number 8 Region: 504-566
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000343
Family Complement control module/SCR domain 0.0066
Further Details:      
 
Domain Number 9 Region: 318-376
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000328
Family Complement control module/SCR domain 0.0092
Further Details:      
 
Weak hits

Sequence:  gi|301605142|gb|XP_002932214|
Domain Number - Region: 634-693
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000101
Family Complement control module/SCR domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301605142|gb|XP_002932214|
Sequence length 695
Comment PREDICTED: coagulation factor XIII B chain-like [Xenopus (Silurana) tropicalis]
Sequence
mgfptcivtplatlsiinnlmgeviqvcikfqdrrgteeginmsaykfcilllcpwfcfa
qeqeqncgpppvvqfgdtleprertnkqgtvitytcpeyyiregnkevvcrngkwddppt
ciepcialekdmianniqlkwtshkklyirdkewigfvcmngyeisnenflriqckrsvl
typkcskigegqscgpppvvqfgdtlqtreptnkhgtvmtykcpeyyiregnekvvcrdg
kwddppiciepctvserdlkanniqlkwtsdkklysrhsewigftcldgyeiseekllri
qcnrsvlpypkcikrgscllsltvmeennvfvngsteiedgktvtflckegwiptdtltq
ecvkreikypncsragnctfpdkitdgnviieaqdgksffsgsslkvkcregfatvgppf
itcnnskwinlpmcarqcqvslpeletnhlklesandvdgiythgnklnvqcksgysskq
kaplrasctngnfmypqcsqtnrcrisqeqldendleldskdedsvyfedgeliqfnckt
gfisstgtvglcaktqityprcteprsctisindpgknkldllrpndiskeyphgtqfqf
kckasyvlppqkqlnaicdngninyprcysinrcrisqeqldenvleldsddeylvyyed
geliqfkckagfisstgtvglcaktqityprctea
Download sequence
Identical sequences gi|301605142|gb|XP_002932214|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]