SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301605144|gb|XP_002932215| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301605144|gb|XP_002932215|
Domain Number 1 Region: 208-271
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000223
Family Complement control module/SCR domain 0.0069
Further Details:      
 
Domain Number 2 Region: 31-85
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000111
Family Complement control module/SCR domain 0.00068
Further Details:      
 
Domain Number 3 Region: 150-205
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000283
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 82-145
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000089
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 399-458
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000406
Family Complement control module/SCR domain 0.0054
Further Details:      
 
Domain Number 6 Region: 335-394
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000435
Family Complement control module/SCR domain 0.0069
Further Details:      
 
Weak hits

Sequence:  gi|301605144|gb|XP_002932215|
Domain Number - Region: 275-330
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000364
Family Complement control module/SCR domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301605144|gb|XP_002932215|
Sequence length 460
Comment PREDICTED: complement factor H-like [Xenopus (Silurana) tropicalis]
Sequence
mvtvwlwnhhaqvqalqtddtallgvlsgkscdqppdienalvtvwkqqykhgesakytc
qagytiseddqakcdegkwrnvpkctstscesapeipnavlmnkknnynsgdraffrcnt
gyvfnmdqnsaicknaqwkelpecrregqscgpppvvqfgdtlqtrertnkhgtkmtykc
peyyilegnrevvcrngkwddppiciepcttserdmkanniqmkwirdkkyysrhnewig
fsclygyeisdekllriqcnrsvlpypkctkigscllsliamdeknivvngsteiedgkt
anflckeglipidtmtqvcnnkkinyptcrsadscqisqeqldengleldskdkasvyfe
drefiqfkcktgltiitgtvglcakthitypkctnveicrisqyqldengleldskdkas
vffehgdliqfkcktgfaittgtmglcaktqityprctki
Download sequence
Identical sequences gi|301605144|gb|XP_002932215|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]