SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301605692|gb|XP_002932495| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301605692|gb|XP_002932495|
Domain Number 1 Region: 184-285
Classification Level Classification E-value
Superfamily Immunoglobulin 1.7e-18
Family I set domains 0.033
Further Details:      
 
Domain Number 2 Region: 353-414
Classification Level Classification E-value
Superfamily BPTI-like 2.13e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0037
Further Details:      
 
Domain Number 3 Region: 407-539
Classification Level Classification E-value
Superfamily TIMP-like 4.19e-17
Family Tissue inhibitor of metalloproteinases, TIMP 0.044
Further Details:      
 
Domain Number 4 Region: 295-354
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000118
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.01
Further Details:      
 
Domain Number 5 Region: 106-151
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000025
Family Ovomucoid domain III-like 0.025
Further Details:      
 
Domain Number 6 Region: 19-71
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000536
Family Elafin-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301605692|gb|XP_002932495|
Sequence length 545
Comment PREDICTED: WAP, kazal, immunoglobulin, kunitz and NTR domain-containing protein 1-like [Xenopus (Silurana) tropicalis]
Sequence
mltillfvlfslralsvpfspvrrhfgicpnqlnanlwvdaqstcerecqsdqdceafek
cctnvcgqkscvaarypdsglpassylrpascngficaqqgsdcelwegrpvcrcrerce
klpgftcasdgltyynkcymdaeacargislvevpckfvsswpitspapsmttplptqaa
tpmempvppalyqspisqsvpiggtvglqcessgrprpeilweklgdgpsapimrpdqmy
gnlvvtnlgqlvvynarpedagiyvcmvrnsagflralfplsvlgkstttapkhhpvhps
ecqklpdrrechgphslqwyydsqsgechtfvhrgcqgngntfytyeecrsscharppdl
cslppvrgpckvpewrwaystmmrqcfsfvyggcqgnlnnfeskqacedrcpqpqvkqcq
gchprgklvpslchsdfvivgkledsgeervlrvvlgevlkddymglhlfhtkylevtlg
egggcpcanlagsgdgqllimgdvqdgmallgpssyirpanekrlrkvkdmldkgtckll
nrfqd
Download sequence
Identical sequences XP_002932495.1.99540 gi|301605692|gb|XP_002932495|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]