SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301605936|gb|XP_002932613| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301605936|gb|XP_002932613|
Domain Number 1 Region: 40-432
Classification Level Classification E-value
Superfamily Sema domain 1.44e-148
Family Sema domain 0.00000000767
Further Details:      
 
Domain Number 2 Region: 435-484
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000301
Family Plexin repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 497-584
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000169
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301605936|gb|XP_002932613|
Sequence length 772
Comment PREDICTED: semaphorin-4C-like [Xenopus (Silurana) tropicalis]
Sequence
merkvhtaggscscctgaaagvretveemdfqrgsvlhavqtecfnyirfleeynqthli
tcgtyafqpkcayialsgftldadnleegkgkvpydpakgytglildgalysatmnnflg
tepvimrivgqhnimkteylaswlnepnfvssahmpesvgseigdddkiyyffteraley
dcsseqvvsrvarickgdlggartlqrkwtsflkarllcsipelqlnfnllksvfkleae
ewrstqffaafqarwgdspvsavcqysihdiqkvfdgpykeyreqsqkwgrysdsvpspr
pgscitnwhrnhgvysslelpdntlnfvkkhplmddtvmpsqgrpllvrrginfttiavq
rtlgldkepydvlfigtdngwvnkavsfgstvhiieelqvfdksypvnslavssrkslly
vgsqsglvqlpfadcskyrscadcilardpycawnvnisrcvradeqhrsvllqdiqdsd
tsvcevqnmnavryfsknitigigtnvvlpcqlssnlaepiwtfdgqdmgsdqddsvlfd
atlqalvilgvgthhsgsyvcfseeqgtrltsenyqltvvaspslilesrapldglglvw
mmvialgavclalflavvylrrklkdelekgsksmentlvypiklpsqpktpkclpsads
deklwdpssfyysdgslkivpghalcqnstgssspsgngipgqplpspplhspnhmllag
vrgsssngyirltlgggvaeehpqlgdlneelrwklkqrqalpdsnpeessv
Download sequence
Identical sequences gi|301605936|gb|XP_002932613|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]