SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301606403|gb|XP_002932829| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301606403|gb|XP_002932829|
Domain Number 1 Region: 159-356
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.6e-56
Family Prokaryotic proteases 0.000000565
Further Details:      
 
Domain Number 2 Region: 371-467
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-20
Family HtrA-like serine proteases 0.0013
Further Details:      
 
Domain Number 3 Region: 29-113
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000628
Family Growth factor receptor domain 0.0026
Further Details:      
 
Domain Number 4 Region: 100-145
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000309
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301606403|gb|XP_002932829|
Sequence length 469
Comment PREDICTED: serine protease HTRA1-like [Xenopus (Silurana) tropicalis]
Sequence
MSPPWSLLPIFFLFLSASAAPGISRRQTPNCPRVCELARCPRIQMPCQAGEVRDSCGCCP
VCGASEGEACGHRGGAPCGEGMECVLPAVGGSARRRIGVCVCSTSEPVCGSDGRTYRNLC
HLKAENRRARLLNSPPAIHIQKGPCDTGSHYPDSLRYKFNFIADVVQKIAPAVVHLELFR
RSPFTGQEMAVSSGSGFIVSDDGLIVTNAHVLTNKQRIKVEVKDGAHYDAKIKDIDQKLD
IALIKIDPDAPLPVLMLGRSADLRPGEFVVALGSPFSLQNTVTTGIISTTQRGGKELGLK
DSDMEYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDRIRQFLAESHDR
QTKGKMLPKKKYMGVRMLQLSSNLIRELKTRDKDFPDVNAGVYVFEVIPGTAAASAGMKD
HDVIISLNGKMVSSTEEVSEAVRNNDTLSIVVRRGNEDIILNVVPEEME
Download sequence
Identical sequences F6RTK3
gi|301606403|gb|XP_002932829| ENSXETP00000033189 ENSXETP00000033189 XP_002932829.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]