SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301606454|gb|XP_002932840| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301606454|gb|XP_002932840|
Domain Number 1 Region: 106-167
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.62e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 253-311
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000405
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 51-116
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000681
Family Complement control module/SCR domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301606454|gb|XP_002932840|
Sequence length 455
Comment PREDICTED: sushi repeat-containing protein SRPX-like [Xenopus (Silurana) tropicalis]
Sequence
mrallqlifmvtlhlylasgyegsgyspveddediyarnrygdkdtpwcspikvknghat
csspyssyyknakgarcniycqkgyelhgasqvicqedkrwsgkylckqkrcptltmpvn
ggfkcidgayfgsrceyycspgyqlkgervvtcmdskvwsgkpptcvdlepprikcpsvk
dkvaepnkvtarvfwetpegrdtadgiltdvilkglpsgtdfqegdhkiqytvydraenk
asckfnvkvrvkrcpklsspdngyikcsgagdnygatcdyfcvggyelqgsparvcqfns
ewsgteptcsfmninvgindaakfldqfyekrrllivstptaadfyyrlqigmlqqgqcg
ldlrhitiielfgvyptyigrigrrilppalgfqlrlllripqnkfqlvvldkhgmdker
yvtpvtntdlftlidvfplrkdeikmqaefghtcn
Download sequence
Identical sequences gi|301606454|gb|XP_002932840| XP_002932840.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]