SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301606468|gb|XP_002932865| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301606468|gb|XP_002932865|
Domain Number 1 Region: 40-233
Classification Level Classification E-value
Superfamily L domain-like 5.44e-36
Family Ngr ectodomain-like 0.017
Further Details:      
 
Domain Number 2 Region: 295-376
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000924
Family I set domains 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301606468|gb|XP_002932865|
Sequence length 518
Comment PREDICTED: amphoterin-induced protein 2-like [Xenopus (Silurana) tropicalis]
Sequence
MSLYCRSSSTKLTINKTNWKDIAYVLLLLISIFHGASGTCPPVCICASDIVSCTNKNLSV
VPRTHFKFIRKLDLSYNKIGFLDPDWFPFLLEKLDTLILNHNTVSSISTGSFSTIPNVRY
LDLSSNNLRTLSNPVFQELKMLEVLLLYNNQLTHIDSGAFGGLHKLQKLYLSGNVLTQFP
VDLFVGRSKLTELVLLDMSYNKIQVVPVQQISLIPARQLSGIYIHENTFVCDCALNSMLN
FWYHRHFSPVVDFKNDYSCILSSDLKTKLLLIQESFLNCSENTVNESFHAYGFLYEAQVG
ERLVVHCDSKIIDAGTQFIWVSPDNRTLEPDIKTDHFHVFYNGSLEIEDAQIGDSGVYSC
IAINKKSLLNETIDIRITVSNFTTNKSQSHEAFNTAFTTLAACVVSIVLVLLYLYLTPCR
CWCKSKKKKRKPNQSSAHSSILSTTPSHDPTNERKSSTGKRVVFLEPVKETEQGQNGKVR
LIQTENLTAESILKTTRSKLDSDSISSVFSDAPFIASV
Download sequence
Identical sequences F7CG25
gi|301606468|gb|XP_002932865| ENSXETP00000063705 ENSXETP00000063705 XP_004913023.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]