SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301606693|gb|XP_002932951| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301606693|gb|XP_002932951|
Domain Number 1 Region: 1089-1288
Classification Level Classification E-value
Superfamily Fibronectin type III 2.57e-40
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 2 Region: 888-1091
Classification Level Classification E-value
Superfamily Fibronectin type III 3.57e-40
Family Fibronectin type III 0.00000186
Further Details:      
 
Domain Number 3 Region: 1384-1564
Classification Level Classification E-value
Superfamily Fibronectin type III 2.92e-30
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 4 Region: 684-787
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-20
Family I set domains 0.02
Further Details:      
 
Domain Number 5 Region: 594-694
Classification Level Classification E-value
Superfamily Immunoglobulin 3.14e-20
Family I set domains 0.021
Further Details:      
 
Domain Number 6 Region: 1290-1389
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-19
Family I set domains 0.019
Further Details:      
 
Domain Number 7 Region: 409-509
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 8 Region: 510-600
Classification Level Classification E-value
Superfamily Immunoglobulin 3.17e-16
Family I set domains 0.057
Further Details:      
 
Domain Number 9 Region: 789-892
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000141
Family I set domains 0.063
Further Details:      
 
Domain Number 10 Region: 314-396
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000118
Family I set domains 0.047
Further Details:      
 
Domain Number 11 Region: 225-302
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000799
Family I set domains 0.011
Further Details:      
 
Domain Number 12 Region: 127-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000169
Family V set domains (antibody variable domain-like) 0.077
Further Details:      
 
Domain Number 13 Region: 41-118
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000472
Family I set domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301606693|gb|XP_002932951|
Sequence length 2048
Comment PREDICTED: Down syndrome cell adhesion molecule-like protein 1-like [Xenopus (Silurana) tropicalis]
Sequence
mllvtlsllcsvhlahledagtslyfvntsllqitfsstvgvfipcpaagspsatlrwyl
gtgddiydvphirhvhangtlqlypfspsafnsfihdndyfctaensagkirspnirvka
vfrepytvrvedqramrgsaavfkcltppsvqeyvsvvswekdtvsltsegrfvtspsga
lyildvqkedalstyrcitrhrysgetrqsngarllvsdpaesvpvlldgfqsqealvge
tvelpciasgypnlasrwikdgrpvpsdsrwskrstglsmadlrledsgtyixetgssyt
haqrigrlplapteplrvtlspkklktgigstvilscslsgspgyivrwyrntehieade
fisirgadnetlvissaqkshsgayqcfgtrkkqtaqdfaivvledgtprilssfsekvm
npgeqfslmcsakgappptitwtlddepiqrdsghrsnqyttadgstvsymnvsspqild
ggvyrcaarnsvgsaeyqarinvrgppsirpmknltavagrdsfihcrvigypyyfiswy
kdslllpdnhrqvvfengtlmlsdvqkgmdegeylcsvliqpqlsisqsvhvtvkvppli
qpfefppasigqllyipcvvssgdmpiritwrkdgqvivsgsgitietkefmsslqissv
slkhngnytciasndaatvsrerqlivrvpprfvvqpnnqdgiygkagvlncsvdgyppp
kvvwkhakgsgnpqqyhpvpltgriqilpnssllirhvleedigyylcqasngvgtdisk
smfltvkipamitshpnttiaikgqtkglnctargerpiiirwekgdtvidpdrnlryli
atkdsgdevistltlkpaergdsvffschainsygedrgliqltvqeppdppelevrevk
arsmnlrwtqrfdgnsiitafdieyknksdswefkqstrnispiinqanivdlhpasvys
irmysfnkigrsepskeltisteeaapdgppmdvtlqpltsqsiqvtwkaprkelqngvi
rgyqigyrengpgsngqysivemkatgdaevytldnmkkfaqygvvvqafnragtgpsst
einattledvpskppenvrvlsitsdvaviswsepprnslngvlkgyrvifwslypdgew
gemqnittprervelkslekftdysvqvlaytqagdgvrsdvlylqtkedipgppagika
vssssssvvvswlpptkpngiirkytifcsspgsgqpapseyetspeflhyrimhllrgq
qymlwvaavtsagrgnfsekvmiepagkapakiisfggtvstpwmkdvrlpcssvgepap
aikwtkdsedsaipvaldghrlihsngtltlrsvkaedsgyytctatntwgfdtiivnll
vqvppdqprltvsktsassitlawipgdnggssirgfvlqysvdnseewrdvfisssers
frlenlrcgtwykvklaaknsvgagriseiieakthgrepsfnkdqplfthvnstharln
lhgwnsggcpitsvileyrpqntwpwqslranvtsdvfltelreatwyelkmracnsagc
gnetsrfatldydgstippiksaqgegddvkklfsiaspvilatlgvallfiirkkrkek
rlkrlrdakslaemlisknnrsfdtpvkgppagprlhidiprvqlliedkegvkqlgddk
atlpvtdaefsqtvnpqsfctgvslhhpaliqntgplidmsdirpgtskfcnpvsrksvk
sahstrnryssqwtltkcqsstpartltsdwrtvgsqhgitvtesdsysaslsqdtdkgr
nsmvstesasstyeelarayehakleeqlqhakfeitecfisdsssdqmttgtnengdsm
tsmstpsepgicrftasppkpqdsdptknvavpiphrakseycnlplymksephfrkpdp
hdscpvvppreasmrnlnrsyhsrhltlepgakpppglshptpsgvslpqrtlllagasa
sapsapaatapsapadptpsvgpvenrlptqhskmggsrdsllemsssggsraqkqgaga
ysksytlv
Download sequence
Identical sequences gi|301606693|gb|XP_002932951|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]