SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301607027|gb|XP_002933125| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301607027|gb|XP_002933125|
Domain Number 1 Region: 988-1172
Classification Level Classification E-value
Superfamily vWA-like 1.14e-38
Family Integrin A (or I) domain 0.0031
Further Details:      
 
Domain Number 2 Region: 66-195
Classification Level Classification E-value
Superfamily vWA-like 2.07e-34
Family Integrin A (or I) domain 0.0015
Further Details:      
 
Domain Number 3 Region: 401-560
Classification Level Classification E-value
Superfamily Fibronectin type III 3.98e-18
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 4 Region: 2602-2659
Classification Level Classification E-value
Superfamily BPTI-like 5.39e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0019
Further Details:      
 
Domain Number 5 Region: 212-303
Classification Level Classification E-value
Superfamily Fibronectin type III 4.29e-16
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 6 Region: 582-749
Classification Level Classification E-value
Superfamily Fibronectin type III 4.41e-16
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 7 Region: 895-980
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000218
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 8 Region: 810-892
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000662
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 9 Region: 757-814
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000019
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 10 Region: 307-353
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000344
Family Fibronectin type III 0.0045
Further Details:      
 
Weak hits

Sequence:  gi|301607027|gb|XP_002933125|
Domain Number - Region: 358-397
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00101
Family Fibronectin type III 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301607027|gb|XP_002933125|
Sequence length 2671
Comment PREDICTED: collagen alpha-1(VII) chain-like [Xenopus (Silurana) tropicalis]
Sequence
mtcplvdpppapqavndkkvseicskylydkcpamsgvgsedervhcpvggttfisilsg
kklsatrteftftthrngtelvqairnlgykggntrtgtglryaadnffgptiirpnvpk
vailitdgksqddvdpptqrlksqgikmfavgiknadsreltrvastptedfffyvndfr
ilgsllpvvtrkvctstggvlitdstsqtytgptnlvfsdqaansmriqwtsatgpvtgy
kvlyvpltglgqqipselreitvtagqtasvlqglraateylvtvtalyansigesvsgr
grtcdsrtgektlgagttsdtlsdlkpnteyvlslypryqsqtgtpvtitgrtqriegvv
qlslqdvtsqsmtatwnrvsgatgyriswvsqsdsgivqvlrtladsptsiqltwniipe
atgyrlewrrarggakapqvvnfptstnrytitglrpgteyqitlftlydgrevatqatt
seteteppvgivtnlrvieaaggrvrlawtgvprateyrvvirsadgtfertrrvpgtqn
tieidglqdgvsysvlvsalvgrregtavpisvriessvvgsvtnlrvldirrgrirlsw
tgvpgateyrilirnsedgseetqvisgdetvyelkdvqegityvvrvtavvgtregnpv
tinvrtesavggvtnlrvlerggnrlriawtgiaratgyrvtwrhsdgrqlsrtlaadvt
sfdieglqansiyaigvsalvgtsegspvtitaqtgvevsqivtrditsvdipdlvpgtp
ytifvsamigsresnpvaitaqtaleqvgsvtslqvlernnivrvtwvgvqgatsykvsw
ipvdggpeqsrevlgninsfelinvrpgvytvkvtaligtrqgspvtasvttpdvpsvtp
vrdlrvsdvsqqrirlnwssvpgstgyriywrradggpetsrlvsrderyididnlqagg
ryefravalfgsqesqavsvfansacgtgrtdvvflvhatqdnayseetvknflskvmss
igqlgpdatqvglsaysfrarpwillnrssdlstvlqqirtipfeepsgtsigaaidfak
nymfttnygrrnnvpgtlvvladgpsgddvleparvmkdagfkilavgtngadqeqlrri
vsrqsprnvfftrdsgnlnslvdsltgaictvtpveepctvqcpqgsagrpgatgppgea
grngipgppgpvgprgppgegtasrgqkgetgdpgtdgipgspgrpgnpgtpaspgergs
pgpsgpkgekgvpvgymkspdemltahdyvgepgevinggggipgrkgepgipgipgqpg
tpgqrgipgtpgppgpegpsgssglpgqsvkgekgergerglpgsvdgaggkgepgspgs
pgaqgqagprgptglsgqkgekgeagegfpgaagrtgdpgdrgprgppgeqgtkgdrgap
gqdgergekgergppgfqglkgpsgglgprgdkgdqgapgepgkstlglpggkgdkgsqg
pagpegpkgsrgdsgekgergppgfgipgqpgakgdqgergnvglagktgqkgepgepgq
ngepgksgppgqiglrgkegdrgekgdegtpgesgipgkngerglrgtqgpqgpqgkpgt
vesvvagakgekgdagdpgehgmkgakgeaganglpgergleglrgppgprgetgdrgtp
gekgergppgvdgrngldgkpgqpgspgqrgdagkqgdpgrdgedgtpgedgrkgdkgdv
gpagrdtaclfnksiasqgrdgqkgtqgepgsvgpagppgvpgnpgpigppgqgdrgeqg
akgeqgrpgemgargepgstanvekslgilgikvaslkdlmdtiddgsgrpitaqmkikg
epgvpgekgapgregtmgfpgergqkgergdlgpagpqgppgraigergpegpsgqtgdp
gkpgipgipgkagepgeqgkagdkgergergergddgkdgargpvgppgpkgevveiiat
glpgergltgprgikgdpgadgekgakgdkgvdgqkgdrgdsgekgrdgspgsvgergla
gpegkpgnpgepgqqgppgiqgptgikgppgpqgiagppglpgppglmgpqgppgvqgqv
gesgkpgvpgrdgspgkdgelglpgkmgmpgppglvgtrgeagepgtpgefvagpsgpkg
ekgapgnqaagipgeagqkgdrglpgargekgskgppgprgekgqagvglpgpagqigpp
glkgdvglpgppgppglqgiagipgqpglrgevgqlgppgqqgerglqgfagregnvgpq
gqsgapgamvsylvlpafvlqgkivlcsnlhidlvfhvtslqgpagppgvkgdkgdsgig
qlgprgergdpgsrglpgnrgergdkgdpgpiglkgdkgetltiegppgprgnkgemger
gikgsegekgdkgdqglhgekgvkgeqgdkgatgfvgargpggqkgetgafgepgepgls
gkdgvpgmrgekgepgihglkgikgdrgmkglcgqdgekgdkgmigvdgtkgdkgspgmt
edevrnfvrqemshhcacggqlsfrvnpvgfvsnypslpsspsnkprlvpvpalkfshid
edddvtipmepaanerrkrdasnqdpctlpmeegdcesytlkwyynqavgecrlfvysgc
ggnlnqfkekkeceqqcnyrnttaksppdgs
Download sequence
Identical sequences gi|301607027|gb|XP_002933125|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]