SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301607270|gb|XP_002933214| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301607270|gb|XP_002933214|
Domain Number 1 Region: 24-71
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000327
Family Elafin-like 0.0025
Further Details:      
 
Domain Number 2 Region: 113-163
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000497
Family Elafin-like 0.0021
Further Details:      
 
Domain Number 3 Region: 71-114
Classification Level Classification E-value
Superfamily Elafin-like 0.000000863
Family Elafin-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301607270|gb|XP_002933214|
Sequence length 165
Comment PREDICTED: WAP four-disulfide core domain protein 5-like [Xenopus (Silurana) tropicalis]
Sequence
mmntgqicviglllcavglctsaakpgrcppeaflaekylshtnrcrsdgdcggnkkccm
dngenfckppaherpgacpfgtrvprktdyctsdsmcpvgskccfreggrtclpsvgvkk
gscppgimincfvpmrsgcqsdstcpgnekccrsgcyseckppnf
Download sequence
Identical sequences XP_002933214.1.99540 gi|301607270|gb|XP_002933214|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]