SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301607313|gb|XP_002933269| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301607313|gb|XP_002933269|
Domain Number 1 Region: 7-86
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.02e-17
Family Thyroglobulin type-1 domain 0.0021
Further Details:      
 
Weak hits

Sequence:  gi|301607313|gb|XP_002933269|
Domain Number - Region: 158-200
Classification Level Classification E-value
Superfamily Amine oxidase N-terminal region 0.0445
Family Amine oxidase N-terminal region 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301607313|gb|XP_002933269|
Sequence length 267
Comment PREDICTED: epithelial cell adhesion molecule-like [Xenopus (Silurana) tropicalis]
Sequence
mtvncnqltpkcrlmhlemlhksrsershpgrdrlevdnvydpeceesgafkakqcdeds
nqcwcvdsagvrvtdktsddpkceklvsvhliqidfifkadfallkgreeelhrilfgkv
shyimkipqilqinihemtyeitmklfcpngtkepvdiatvayyierdlkqnkftlpldg
rnievdrdsirvlffdnepprinmktispgfaaiiiiialailtgiavfvvvqrraeqer
vqfeviegqeledynlaqreslryyyy
Download sequence
Identical sequences gi|301607313|gb|XP_002933269|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]