SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301607528|gb|XP_002933360| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301607528|gb|XP_002933360|
Domain Number 1 Region: 37-124,169-297,330-445,535-612
Classification Level Classification E-value
Superfamily MFS general substrate transporter 4.05e-35
Family LacY-like proton/sugar symporter 0.053
Further Details:      
 
Domain Number 2 Region: 461-501
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000277
Family Ovomucoid domain III-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301607528|gb|XP_002933360|
Sequence length 707
Comment PREDICTED: solute carrier organic anion transporter family member 3A1-like [Xenopus (Silurana) tropicalis]
Sequence
mpgktnrsssgrsgdpqgdeaqrkkkkkktscflnikiflvsecalmlaqgtvgaylvsm
lttlerrfnlqsadvgviassfeignlalilfvsyfgarghrprligcggivmalgalls
alpeflthqykyepgeirwgaegrdicsindtssgeipdpdiicsntattnmmyllliga
qvllgigatpvqplgvsyiddhvrrkdsslyigilftmlvfgpacgfilgsfctkiyvda
fltdtsklditpddprwigawwagfllcgvllffssllmfgfpqslspridrseeseqtm
lpdteyerpkpsngvlrhysetedgtscfqqlrvipkvtkhllsnpvftcivlaacmeia
vvagfaaflgkyleqqfnlttssanqllgmtaipcaclgiflggllvkklslsalgairm
amlvnlvstacyvsflflgcdtgpvagvtvpygnisvpgasveryascntdcecqtdsft
pvcgadgitylsacfagctkmnlagcsclssvpvenntvvpgkcpspgcqeafltflcvm
cvcsmigamaqtpsviiliravspelksyalgvlflllrligfippplifgagidstclf
wstfcgtqgacalydnvayrylyvsiaitlkslafilytttwqclrknykryiknheggl
saseffastltldnlgkdsvsqnkthrtkfiynledhewcenmesvl
Download sequence
Identical sequences XP_002933360.1.99540 gi|301607528|gb|XP_002933360|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]