SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301607912|gb|XP_002933540| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|301607912|gb|XP_002933540|
Domain Number - Region: 98-160
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0183
Family LacY-like proton/sugar symporter 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301607912|gb|XP_002933540|
Sequence length 240
Comment PREDICTED: palmitoyltransferase ZDHHC2-like, partial [Xenopus (Silurana) tropicalis]
Sequence
xxxxxxxxpavppakfrlseadkqlylsderpevlqkilvrmakdlpihntqgsrrairy
cmicqglkpdrcyhcpvcdicvlkldhhcvflnncvgfsnykffllcvlyallmclftsa
vslyysvlfwthrlpnteskvpiivlfvmtalfsiflflfflahfplaswnqtarensdd
ndesnpydlgcsknlrqvfgnekrywflpifsslgdgssfpmgdatedieknaalvgqip
Download sequence
Identical sequences gi|301607912|gb|XP_002933540|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]