SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301608470|gb|XP_002933812| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301608470|gb|XP_002933812|
Domain Number 1 Region: 4831-5045
Classification Level Classification E-value
Superfamily GFP-like 2.09e-58
Family Domain G2 of nidogen-1 0.0004
Further Details:      
 
Domain Number 2 Region: 4127-4225
Classification Level Classification E-value
Superfamily Immunoglobulin 7.12e-25
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 1648-1735
Classification Level Classification E-value
Superfamily Immunoglobulin 3.42e-24
Family I set domains 0.0053
Further Details:      
 
Domain Number 4 Region: 3953-4042
Classification Level Classification E-value
Superfamily Immunoglobulin 4.29e-24
Family I set domains 0.011
Further Details:      
 
Domain Number 5 Region: 2472-2570
Classification Level Classification E-value
Superfamily Immunoglobulin 6.57e-24
Family I set domains 0.0052
Further Details:      
 
Domain Number 6 Region: 1731-1828
Classification Level Classification E-value
Superfamily Immunoglobulin 2.38e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 7 Region: 4391-4488
Classification Level Classification E-value
Superfamily Immunoglobulin 6.77e-23
Family I set domains 0.012
Further Details:      
 
Domain Number 8 Region: 2963-3060
Classification Level Classification E-value
Superfamily Immunoglobulin 7.85e-23
Family I set domains 0.0072
Further Details:      
 
Domain Number 9 Region: 2379-2479
Classification Level Classification E-value
Superfamily Immunoglobulin 8.55e-23
Family I set domains 0.014
Further Details:      
 
Domain Number 10 Region: 2786-2870
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-22
Family I set domains 0.042
Further Details:      
 
Domain Number 11 Region: 2007-2106
Classification Level Classification E-value
Superfamily Immunoglobulin 1.33e-22
Family I set domains 0.0028
Further Details:      
 
Domain Number 12 Region: 2578-2666
Classification Level Classification E-value
Superfamily Immunoglobulin 2.23e-22
Family I set domains 0.015
Further Details:      
 
Domain Number 13 Region: 3628-3720
Classification Level Classification E-value
Superfamily Immunoglobulin 3.08e-22
Family I set domains 0.019
Further Details:      
 
Domain Number 14 Region: 43-218
Classification Level Classification E-value
Superfamily vWA-like 6.18e-22
Family Integrin A (or I) domain 0.026
Further Details:      
 
Domain Number 15 Region: 612-703
Classification Level Classification E-value
Superfamily Immunoglobulin 9.19e-22
Family I set domains 0.0078
Further Details:      
 
Domain Number 16 Region: 2879-2967
Classification Level Classification E-value
Superfamily Immunoglobulin 9.86e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 17 Region: 2297-2386
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-21
Family I set domains 0.0065
Further Details:      
 
Domain Number 18 Region: 1913-2013
Classification Level Classification E-value
Superfamily Immunoglobulin 1.6e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 19 Region: 1092-1181
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 20 Region: 1451-1548
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-21
Family I set domains 0.02
Further Details:      
 
Domain Number 21 Region: 1822-1920
Classification Level Classification E-value
Superfamily Immunoglobulin 3.91e-21
Family I set domains 0.0074
Further Details:      
 
Domain Number 22 Region: 2679-2765
Classification Level Classification E-value
Superfamily Immunoglobulin 3.95e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 23 Region: 3243-3343
Classification Level Classification E-value
Superfamily Immunoglobulin 7.43e-21
Family I set domains 0.0075
Further Details:      
 
Domain Number 24 Region: 4035-4132
Classification Level Classification E-value
Superfamily Immunoglobulin 7.7e-21
Family I set domains 0.0078
Further Details:      
 
Domain Number 25 Region: 3712-3802
Classification Level Classification E-value
Superfamily Immunoglobulin 7.76e-21
Family I set domains 0.0086
Further Details:      
 
Domain Number 26 Region: 4318-4407
Classification Level Classification E-value
Superfamily Immunoglobulin 9.42e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 27 Region: 519-617
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-20
Family I set domains 0.024
Further Details:      
 
Domain Number 28 Region: 1268-1360
Classification Level Classification E-value
Superfamily Immunoglobulin 1.97e-20
Family I set domains 0.0073
Further Details:      
 
Domain Number 29 Region: 3337-3436
Classification Level Classification E-value
Superfamily Immunoglobulin 2.65e-20
Family I set domains 0.0074
Further Details:      
 
Domain Number 30 Region: 3856-3951
Classification Level Classification E-value
Superfamily Immunoglobulin 3.01e-20
Family I set domains 0.034
Further Details:      
 
Domain Number 31 Region: 1367-1454
Classification Level Classification E-value
Superfamily Immunoglobulin 4.77e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 32 Region: 1171-1263
Classification Level Classification E-value
Superfamily Immunoglobulin 5.26e-20
Family I set domains 0.0067
Further Details:      
 
Domain Number 33 Region: 1541-1639
Classification Level Classification E-value
Superfamily Immunoglobulin 6.46e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 34 Region: 793-887
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 35 Region: 3068-3154
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-19
Family I set domains 0.0082
Further Details:      
 
Domain Number 36 Region: 895-988
Classification Level Classification E-value
Superfamily Immunoglobulin 1.63e-19
Family I set domains 0.015
Further Details:      
 
Domain Number 37 Region: 702-790
Classification Level Classification E-value
Superfamily Immunoglobulin 1.66e-19
Family I set domains 0.019
Further Details:      
 
Domain Number 38 Region: 2101-2196
Classification Level Classification E-value
Superfamily Immunoglobulin 3.4e-19
Family I set domains 0.0065
Further Details:      
 
Domain Number 39 Region: 3443-3530
Classification Level Classification E-value
Superfamily Immunoglobulin 3.79e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 40 Region: 977-1075
Classification Level Classification E-value
Superfamily Immunoglobulin 3.83e-19
Family I set domains 0.023
Further Details:      
 
Domain Number 41 Region: 4213-4309
Classification Level Classification E-value
Superfamily Immunoglobulin 8.19e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 42 Region: 3523-3623
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-18
Family I set domains 0.0099
Further Details:      
 
Domain Number 43 Region: 3167-3248
Classification Level Classification E-value
Superfamily Immunoglobulin 2.06e-18
Family I set domains 0.0054
Further Details:      
 
Domain Number 44 Region: 2190-2291
Classification Level Classification E-value
Superfamily Immunoglobulin 6.72e-18
Family I set domains 0.0092
Further Details:      
 
Domain Number 45 Region: 4658-4715
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000144
Family TSP-1 type 1 repeat 0.0002
Further Details:      
 
Domain Number 46 Region: 4544-4601
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000314
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 47 Region: 4488-4544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000085
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 48 Region: 4772-4829
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000157
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 49 Region: 4715-4772
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000235
Family TSP-1 type 1 repeat 0.00026
Further Details:      
 
Domain Number 50 Region: 449-526
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000567
Family I set domains 0.047
Further Details:      
 
Domain Number 51 Region: 4600-4658
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000654
Family TSP-1 type 1 repeat 0.00028
Further Details:      
 
Domain Number 52 Region: 5226-5271
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000622
Family EGF-type module 0.015
Further Details:      
 
Domain Number 53 Region: 5097-5219
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000573
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 54 Region: 3812-3860
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000728
Family V set domains (antibody variable domain-like) 0.068
Further Details:      
 
Domain Number 55 Region: 5062-5114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000138
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  gi|301608470|gb|XP_002933812|
Domain Number - Region: 5258-5301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00519
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301608470|gb|XP_002933812|
Sequence length 5422
Comment PREDICTED: hemicentin-1 [Xenopus (Silurana) tropicalis]
Sequence
mfpcrtlclqyllllllvqlliqnscgvaepetpyipdgastlafvfdvtgsmyddlvqv
iegaskiletslnrpkkplynfalvpfhdpeigpvtittdpekfqnelkelyvqgggdcp
emsvgaikialeislpgsfvyvftdarskdyqltnevlqliqqkqsqvvfvltgdcddrs
hhgykvyeeiastssgqvfhldkkqvnevlkwveeavqaskvhlistdhsggashtweip
fdpslkevtvslsgpspgielydpsgkrmtpetglnellnifnsakvinmkepvpgmwki
ktssngrhsvrmtgvstidfrvgfsnkptldfsktssrpiqgiptyvllntkglsypakv
erlellttsgsllktlpikyypdrtpyeiwnvteffppneaffikiigydkddylfqrvs
svsfsniipgapkvsmpkitpgyylqsgsvpcfveslipvtvrfskngvklgtdqkfres
vnasweianvsvsdegyydcyasssagsaraqtfldvnepppvikapsnitvtvgkgail
tcdvvstvrfnltwlrnnldlkhmnpsklsilrnnsleiksvtiddggeyncfasneggt
atasvtliaqdppkavleprnvtftkgaeiklkclvtgyptphiiwmhndmfvrfsnryi
ithngtfiiknaverdsgvykclatnaagtdhqtsvmvyievpqvtavknemlvpvgset
tlackatgiprplihwykeniklspsalitidsllgtlkikntqfsdaghyvciavndag
kangkvslrvgsppvftqtpgdvsmdigsdvsltcsaegipepkikwrrlnhtsesskpl
syqynsqqkagtlqinklwvgdegiyiceaenqfgkissqatitvtglvvpvigespsvv
sviegnqvtlpcvllvgnplperhwvkdnvvlvtnpytsiradgslhlervllkdggdyl
ctaknvagtadrittinvhvspviqhgpqifstiegiavslpckasgvpkptiiwkkkge
ivvpnndtiiaesdgtlllsspggedsgeyscsainaagyaarkvqltvyvkprivspda
ngssiaqknqieisvragddvilpcevksvpppfitwaketqlispfsqrhsifpsgslk
ifetrvsdagmytcvgtniagnitqlvklsvyvppkiqrgpklirvklghsfeiacishg
ippptaawykdgqimefdqgqdnnmlrvesakpsdggtytcvasnvigtdsanatveiya
pptlsdleppynkqnqerisrqqisfpcpvkghpkpvikwfrngkeltgsepgvnivedr
avlvidsltpydngeytcvasneagqtekkyslkvhdpplikdmdiisnvsvllhqtmsl
lceasgsppplitwykgrtqvdesatvqilekgkilkilkmalkdsghytckanniages
kkqyfvnvldpptiagvgtisdvsviagrevnleckvkgipfpsiqwfkenrllstedpn
vvmlengqvlhikhsrlsdsgkykciaantagsqtkeikltvyiaptikdgnsttdlsft
vngeinlecdargippptiiwykdgepllpspyvtyiqkgkylritesqitdggtytcsv
tnvagqteknysvdiyvparihgdekkhqnkkvivgksltleceatghppplitwlkdgv
pvetndnirlhyngkkleirntveydrglytcvavnvagetemkykvsvlvppsieggnd
padhtviasgaveleclasgtplpsvmwlkngtpvdtsgrliiqsnghkllisstessds
gnyqcvvkneagsstkqfnvvvhvrptikpvaspvsilmhkattlqciasgipnphitwl
kdglpfnvakanikmesfgrslqfkktlledagkytcvatnaageaeqtiwlnvyeppki
ensgeliqetvlanhniileckatgnpdpvvtwfkdnqqltntgdisvsdrgqvlqisga
qvfhagtykcvaasiagraelsynlqvhvppsisgrsssitvivnnvvrleceatgfpap
sltwlkdgspvssftngiqilsggrvlaltnaqvgdagkytcvavnaageqqtdydlsvy
vppnimgeeqnisslisetlilkcesdaipppvltwykdwkplvnrpgltisedgsilki
egaqvkdtgrysceavniagkteknfnvnimvppairgsaeesevniiegtlisllcdst
gipppalawkkndvaiqsgaaghirllsggrqlqiitarksdaasytctasnsvgsamkk
ytvkvyvrpsisesgnhpseivviqgnnvtlecdargdpqpmltwlkegiplisgngfei
ssngrllhlqkaqisnaglyvcvavnvagqsdrkydlkvfvppafpdgimkhenisivek
npftltcevsgipppkvtwykdgnpippsrspqimsggfllrfsqsslsdtgrytcavsn
aagedmrkfdvnvlvppkitgsvqeeikvkergnitlsceatgtpipqitwlkdghpvle
dtnhridhkgqllrisnvmmtdsgryvcvasnpagersrsfslgvlisptikgaingspe
dvkvvllssislecevhshppatitwhkdgrlfkfkdnvrilpggrtlqilkaqekdagr
ysciatneagegthhynlnvhippkirkddisefggfskeikaivntnftlvcdvkanpl
akitwykdgqplepdshlaivsgntlyvekaqvsdtgrytclasniagedeldfdvtiqv
ppnfpklsglwttsksstgssngehkeviinnpfslycetnavppptitwykddklltps
nrafilpgghilqiaraqeddagtytcvavneagrdsmhynvrvllppafegsdedlskd
itslvnetlemdctvavtgspaptiswlkdghpiqegtryhfltngrtlkilyaqlmdtg
ryvcvvenpagsvqksfnlniyvppsvigsnsenvtvvesnfisltcevtgfpppavswl
kdtmvlnsdshlfivpggrtlqipqtrlsdvgeysciainqageakktffldiyappsiv
anvrdsstevnvkvnastilecesnaipapvinwykngqpiretssyqfleggqrlnirn
aqvfdtgeyecivtnvvgqdnkkfflnvyvhpsiqglqneyhngiiqnsvtfscdaygip
vptlrwlkdghpigltdsleiqilsggskmkiaraqltdggtytclasnvegtaektyil
tiqvppsidgsgmtnelnvlpgeiiqlicnakgiptpvihwlkdgkhitsedylginits
dgeiltisktqtsdmgkytcvatnpageddriynvnvfvapkiddnkgtpvvltavldts
invechasgfptpqinwlknglplpvssqvrlqsggqvlrisrvqksdgatytciasnra
gvdkkdyniqvyvspsldeadvtqqitvirddpvvmrciangvpapriswlkdgkqlgde
ylpyiqsqgmvlhivkakmddiarytcvasnaagrvskhfilnvmepphingsevteels
vvvnthldllcyttgfppplitwlkdgqplsqndnmhlmkagqvlritsaqvenvgrfvc
lasnhagdtkkeflvkvhippniagvsgtqnitvlqkkqitmecksdalpppritwlkdg
qplqpspmvhilsngqfvqidntevtdtgrytciatniagkttkefilniqvppsieegp
slvtafvdepvtlecissgvplpktawrkdgsllshhnarflvsqngslyisavevadsg
qyfclatnaagssqrqidllvygmynsamtqdmrqllssgslviispsvddtgiyvcsal
sdagddeidmylsvhvpptiadeaanifvtklspavipctvsgvpfpsvhwlkdsiqlpa
isdsyrilpsgsleipssrlshagkytcravnqvgsahihvnlhvqevpvikeqndylev
vlsnsvtlaceasgtpiptiswqkegvgiksgssytilsngnlniasatqedagtytcia
qnpagtalkkvrlkvhvppvivphqkeyvismdksimivceahgsptpeiiwhkdgvpla
klagqrmsatgglhiavvqpddageytctaeniagsvnssmnlsvlvpprivknikdvsv
vindqttlpcaahgiptptitwaknnlpitvkagkysvlasgelilynaqhkdvgtytct
asnaigedthtvrltvhfppsftemptivslnegerlsllckatgnplphttwifkdkil
pvlqdrrskqqnelvidkvsrensgaymcvaenivasinttihvfvkeppvlngvhnkhr
tvplggniilncvvkgnpfpkiqwhkkakvisynkhikefsngslaiydagledvgdytc
iaandagvlehtvtltlqrpptikvppldttvdagatvalncqsegepvptitwyrhnnp
issedritilpnnslqivsaqkedtsvyeckatnimgtdvvkvtftvqvhggfsewlpwq
scsvtcgqgiqrrirlcdnplpanggnycqgaetetrscqnklcpvdgnwsewstweecs
rscgsgkrtrvrtcsdppaqeggkpcigkavdvavcnvkpcpvhgmwgpwqswgactktc
wkgtkmrvrlcnnptpspdglpcegqdtqmqicgdrqcpvdgkwsawgswtscslscggg
lrqrtracsnpapqygghkcegnehenemcnadlcpvhgnwgpwshwgscsrtcnggqmr
ryracdnpapshsgractgtdtetnkcntdlcpahgnwgqweawskcsvscgggeqirtr
vchhparsytgrpcpgdstqllrcnvqacpggpqrvkgnlfgrindldfgmaplnatitd
dpnsgsrilqakftnipkslgpsmrnlvsllnpiywttakeigeavngfsltggifkres
qvefatgeilkithtargvesdgsllldtvvkgnvlqlqtsvdihlkdytedyiqtgpgq
vhaystrmfsvdgvyvpytwnhtinydvgqgtmpfltetlqvnsietdynpqeeslsfqv
hasisrgdlsiqcpsgfsldstglyctdidectledsicrknqeckntvgsyicgvkcgv
gfraaandlvcqdineclesnpchqrclnsvgsyhcgcdtgyqlkgrrcidlnecrhgvc
rqdqlckntrgsykcidvcpigltraengtcvdinecqdgthlcknnqicentlggylyi
necekgdvcqhecrnvlgsykclcppgyqlmangktcqdidecleqniqcgmnrmcfnmr
gshqcidtpcppnyirdtisgyclkncapndlecalspyalqyklvslpfgiaanqdlir
lvaytedgilhprttflitddyaslpfsireenmkgvvftnrplqkpetyrmkvkalsys
idrtieyqtafivyiavspypy
Download sequence
Identical sequences gi|301608470|gb|XP_002933812|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]