SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301608507|gb|XP_002933828| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301608507|gb|XP_002933828|
Domain Number 1 Region: 38-181
Classification Level Classification E-value
Superfamily C-type lectin-like 5.25e-30
Family C-type lectin domain 0.00000816
Further Details:      
 
Domain Number 2 Region: 196-261
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000139
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 251-317
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 4 Region: 313-380
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000445
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301608507|gb|XP_002933828|
Sequence length 433
Comment PREDICTED: e-selectin-like [Xenopus (Silurana) tropicalis]
Sequence
mhqknskicltfvwwalkvfvtlfvfsamlqvspvqcwtyhysvenmnydqarvfcknsy
tdlvaiqnkeeieylnkaiplnptyywigirkisgtwtwvgtnktlteeaqnwgkgepnn
kknkedcveiyiqrqndtgkwnddacikkkralcytascnkricgehgecietinnytcs
chegfygshcqnvvkcedlkhlpnghincthpwgefsyqsscrfacsegfhinglnetqc
lssggwsrespqctaiqceslptqphrymncshplgefsfqssckfacsegfhlngshet
eclssgawsrepphctvvqceslsgqtqeyiyincthpwkessfqskcrfrcsegshlfe
pdeieclasgtwtrspphctgqmashnheqdhskllvitggataasaialalvawlisrk
lkkgkkklrsasy
Download sequence
Identical sequences gi|301608507|gb|XP_002933828|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]